KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_02321Help
Entry
BSUB_02321        CDS       T03442                                 

Definition
(GenBank) yokJ
  KO
K21490  antitoxin YokJ
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Brite
KEGG Orthology (KO) [BR:bsut00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsut02048]
    BSUB_02321
Prokaryotic defense system [BR:bsut02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YokI-YokJ
    BSUB_02321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMI1_KNR4 SUKH_6
Motif
Other DBs
NCBI-ProteinID: AIC44833
LinkDB All DBs
Position
complement(2247968..2248465)
Genome map
AA seq 165 aa AA seqDB search
MSIDMLIKKIASTSDCRLFEADGLPVIDEKHQLPKDISEFYEQCGGAVLYENADYPIYIV
RPAEFELANPIIVGELCEEDISSEWYIVCTDGKGEYLTIDLNDQRKGKCYDSFFDRHGIV
GETQVIASSFTDLIQRLLENKGKHWYWLRDDYVSLGDAYDGIEIE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgagcattgacatgttaatcaagaagattgcttctacatcagactgtcggctgtttgaa
gctgatggtctcccagtaatagacgagaagcatcaactaccaaaagatattagtgaattt
tatgaacaatgtggtggagcagttttatatgaaaatgcggattatccaatatacatagta
cgaccagctgagtttgaattagctaatcccattattgttggggagctctgtgaagaagac
atttcatccgagtggtatattgtttgcacggatggaaaaggagaatacctaacaattgac
ttaaacgatcagcgaaaaggaaaatgctatgacagtttttttgatcgacatggaatagtc
ggcgaaacacaggtgatagcaagttcatttacagatttaatacagcgactgcttgaaaat
aagggtaaacattggtattggttaagggatgattatgtatcactaggcgatgcatatgat
ggcatagaaattgaataa

DBGET integrated database retrieval system