KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_02889
Entry
BSUB_02889        CDS       T03442                                 

Gene name
levD
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IIA component
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Pathway
bsut00051  Fructose and mannose metabolism
bsut02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSUB_02889 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSUB_02889 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsut02000]
    BSUB_02889 (levD)
Enzymes [BR:bsut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BSUB_02889 (levD)
Transporters [BR:bsut02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSUB_02889 (levD)
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AIC45397
LinkDB
Position
complement(2735161..2735601)
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHE
VLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSLREHLALKDLLNNLKAMS
QQSFQVCSEHLEKVKTANQDTREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgattgcagtgccgtttttcaaaggggaagga
atacaaacgctgcaagaaaaatatcatcaggcgctcaaggatatcccggaagaacatgaa
gtgctttttttagtcgatatttttggagggacgccatataacgcggcagcttcctttatt
gctgaggatcaaagaatggatatggctgccggcgtaaacctgccgattctgctggaggta
ttaagcctgagagaacatctggctctcaaagatttgctgaacaacttaaaagcaatgagt
cagcaaagctttcaagtgtgcagtgaacatttagaaaaagtaaaaacagccaatcaagat
acaagagaggatgaattatga

DBGET integrated database retrieval system