KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_03448Help
Entry
BSUB_03448        CDS       T03442                                 

Definition
(GenBank) yutE
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF86
Motif
Other DBs
NCBI-ProteinID: AIC45929
LinkDB All DBs
Structure
PDB: 

Position
complement(3296866..3297300)
Genome map
AA seq 144 aa AA seqDB search
MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGF
IMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQT
ALQDFPKRIRSYLETELGPVSAFK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgttgacagaagcaaaatcgaaaaaacactagggttcttcgagcaccagctg
gcgctatttgactcacaaacagactggcagtctgaaatcggggaattggcacttcagcgt
ataggccatctgttaatcgaatgcattttggatacaggcaatgacatgattgacggcttt
attatgcgggacccgggcagctatgacgacattatggatatacttgttgatgagaaagtt
gtcacggaaaaagagggtgatgagctcaaaaaattgatcgcctaccgcaaaacgttggtt
caacagtatctgctcgctgacagcggcgagctttacaggctgatcaaggcgcatcaaaca
gctcttcaggacttcccgaaacggatcagaagctatttggaaacagagctaggacctgtt
tccgcgtttaaataa

DBGET integrated database retrieval system