KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_04328Help
Entry
BSUB_04328        CDS       T03442                                 

Gene name
yyaR
Definition
(GenBank) acetyl-transferase
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9 Acetyltransf_CG Acetyltransf_3 Acetyltransf_13 PanZ
Motif
Other DBs
NCBI-ProteinID: AIC46800
LinkDB All DBs
Position
complement(4163194..4163715)
Genome map
AA seq 173 aa AA seqDB search
MIMKMTHLNMKDFNKPNEPFVVFGRMIPAFENGVWTYTEERFSKPYFKQYEDDDMDVSYV
EEEGKAAFLYYLENNCIGRIKIRSNWNGYALIEDIAVAKDYRKKGVGTALLHKAIEWAKE
NHFCGLMLETQDINISACHFYAKHHFIIGAVDTMLYSNFPTANEIAIFWYYKF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaaaatgactcatttgaatatgaaagatttcaataaaccaaacgaacctttc
gttgtttttgggagaatgatacctgcttttgaaaacggtgtttggacatatactgaggaa
cgattttctaaaccttattttaaacaatatgaagatgatgacatggatgttagttatgtt
gaagaagaggggaaagcggcttttttatattatcttgaaaacaactgcattggccggatt
aagatccgttctaactggaatgggtatgcactaatagaggacattgccgtggcaaaagac
tatagaaaaaaaggtgttggaacagcattattacataaagcgattgagtgggcaaaggag
aatcatttttgtggtcttatgcttgaaacccaagatattaatatttcagcttgtcatttt
tatgccaaacatcactttataataggtgcggttgatacgatgctttattccaactttcca
acagcaaatgaaattgcgattttttggtactataaattttaa

DBGET integrated database retrieval system