KEGG   Brucella suis bv. 2 PT09172: BSPT2_I0144Help
Entry
BSPT2_I0144       CDS       T03504                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
bsuv  Brucella suis bv. 2 PT09172
Pathway
bsuv00620  Pyruvate metabolism
bsuv01100  Metabolic pathways
bsuv01120  Microbial metabolism in diverse environments
bsuv01200  Carbon metabolism
Module
bsuv_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:bsuv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSPT2_I0144
Enzymes [BR:bsuv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     BSPT2_I0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog AlaDh_PNT_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AIB23624
LinkDB All DBs
Position
I:complement(153722..155122)
Genome map
AA seq 466 aa AA seqDB search
MPASTPKGNISERAPTASEKEALDFHAQGRPGKLEINPTKPMTTQRDLSLAYSPGVAVPV
KAIAEDAARAYDYTAKGNLVAVISNGTAILGLGNLGALASKPVMEGKAVLFKRFADVDSI
DLEIDTTDIDAFINAVRYLGPSFGGINLEDIKAPDCFIIESRLRELMDIPVFHDDQHGTA
IIAAAGLINALHLTGRDMKTTKLVCNGAGSAGIACIELIKAMGFAPENVILCDTKGVVYQ
GREEGMNQWKSAHAVKTDRRSLADAMKDADVFFGVSAKGALTQDMVRSMAPNPIIFAMAN
PDPEITPEEVERIRDDAIVATGRSDYPNQVNNVLGFPYIFRGALDVRATTINDAMKIAAV
NALAELAREDVPDDVVAAIRAAARALGRTISFRCRSIRACLPPFPPPSPRLRWKPAWPGA
PLPILKATSANCWRAATRSPRRCAAFTSVCAASQSASYLPKARKNR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgccagcctcgacgccgaagggcaacatatcagaacgcgcacccacagccagtgagaag
gaagcgctcgactttcacgctcaggggcgccccggcaagctggaaatcaacccgaccaag
ccgatgaccacgcagcgcgacctgtcgctcgcctattcgccgggcgtggccgtgccggtg
aaggccatagccgaagatgccgcccgcgcctatgactatacggccaagggcaatctcgtc
gccgtcatttccaatggcaccgcgatcctcggcctcggcaatctgggcgcgcttgcctcc
aagccggtgatggaaggcaaggctgtgctgttcaagcgttttgccgacgtcgattccatt
gatcttgaaatcgatacgaccgatatcgacgctttcatcaatgcggtccgctatctcggc
ccctccttcggcggcatcaaccttgaagacatcaaggcgccggattgcttcatcatcgag
agccgcctgcgcgaattgatggacattcccgtcttccacgacgaccagcatggcacggcc
atcatcgcggctgcgggccttatcaacgcactgcaccttacgggccgcgacatgaagacg
acaaagctcgtctgcaacggtgccggctcggccggcatcgcctgtatcgagcttatcaag
gccatgggttttgctcccgaaaacgtcatcctgtgcgacaccaagggcgtcgtctatcag
ggccgtgaagagggcatgaaccagtggaaatcggcccatgcagtaaagaccgatcgccgc
tcgcttgccgacgccatgaaggatgcggacgtgttcttcggcgtttcggccaagggtgcg
ctgacgcaagacatggtgcgctccatggcgcccaatcccatcattttcgccatggccaat
cccgacccggaaatcacgccggaggaggtggagcgcatccgtgatgacgccatcgtcgcc
acgggccgttcggattatccgaaccaggtcaacaatgtgcttggctttccgtatattttc
cgcggtgcgctcgacgtacgcgcgacaaccatcaatgatgcaatgaagatcgccgccgtc
aatgcgctggccgagcttgcccgcgaggacgtgccggacgatgtggtggcagccatcagg
gcagccgcccgcgctttgggccgaactatatcattccggtgccgttcgatccgcgcctgc
ttgcccccgtttccgccgccgtcgccaaggctgcgatggaaaccggcgtggccgggcgcg
ccattgccgatattgaaggctacaagcgcgaattgctggcgcgccgcgacccgatcgcct
cgacgctgcgcggcatttacgagcgtgtgcgccgccagccaaagcgcatcgtatttgccg
aaggcgaggaagaacaggtga

DBGET integrated database retrieval system