KEGG   Brucella suis bv. 2 PT09172: BSPT2_I1828
Entry
BSPT2_I1828       CDS       T03504                                 

Definition
(GenBank) Shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bsuv  Brucella suis bv. 2 PT09172
Pathway
bsuv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsuv01100  Metabolic pathways
bsuv01110  Biosynthesis of secondary metabolites
bsuv01230  Biosynthesis of amino acids
Module
bsuv_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsuv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSPT2_I1828
Enzymes [BR:bsuv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BSPT2_I1828
SSDB
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 RsgA_GTPase AAA_30 AAA_22 TsaE APS_kinase AAA DUF5713 6PF2K SRP54 AAA_17 AAA_5 AAA_16 DUF815 ABC_tran
Other DBs
NCBI-ProteinID: AIB25272
LinkDB
Position
I:complement(1766481..1767083)
AA seq 200 aa
MSGTNKQTNLHRQTETIRQLLGSKVVVLVGLMGAGKSTIGRKVANMLNLPFKDADTEIET
VSRMTVAELFEAYGEVEFRDLERRVILRLLDDGPMVLATGGGAYMNAETRAAIAEAGISI
WINADLDVLMERVSRRQNRPLLRNSDPRGVMQRLMDERYPVYALAELHLMTRDEKKEVIA
AELIEVLAAHLEKEQAASAG
NT seq 603 nt   +upstreamnt  +downstreamnt
atgagcggtacgaacaaacaaacaaatcttcacaggcagacggaaacgatccgccagctg
ctcggcagtaaagtggttgttctcgttggcctgatgggagccggaaaatccaccatcggc
cgcaaggtggcgaacatgctcaacctgccgttcaaggatgcggatacggaaattgaaact
gtttcgcggatgactgttgccgaactgttcgaggcctatggggaagtggaatttcgcgat
ctcgaacgtcgcgtgatcctgcgccttctcgatgacggccccatggtgctggcgaccggc
ggcggcgcctatatgaacgccgaaacccgcgcggcgattgccgaagcggggatttccatc
tggattaatgccgatctcgacgtcttgatggagcgcgtttcgcgccgccagaaccgtccc
cttttgagaaacagcgatccgcgcggcgtcatgcagcggctgatggacgagcgctacccg
gtttatgcgctggccgagctgcatctgatgacgcgcgatgagaaaaaggaagtgattgcc
gcagaactgatcgaggttctggcggcgcatctggaaaaggaacaggccgcttccgccgga
tga

DBGET integrated database retrieval system