KEGG   Brucella suis VBI22: BSVBI22_A0421Help
Entry
BSVBI22_A0421     CDS       T01706                                 

Gene name
fabI-1
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00061  Fatty acid biosynthesis
bsv00780  Biotin metabolism
bsv01100  Metabolic pathways
bsv01130  Biosynthesis of antibiotics
bsv01212  Fatty acid metabolism
Module
bsv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSVBI22_A0421 (fabI-1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSVBI22_A0421 (fabI-1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BSVBI22_A0421 (fabI-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsv01004]
    BSVBI22_A0421 (fabI-1)
Enzymes [BR:bsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BSVBI22_A0421 (fabI-1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BSVBI22_A0421 (fabI-1)
Lipid biosynthesis proteins [BR:bsv01004]
 Fatty acid synthase
  Component type
   BSVBI22_A0421 (fabI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AEU05446
LinkDB All DBs
Position
I:423975..424793
Genome map
AA seq 272 aa AA seqDB search
MTAQSGLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELG
AFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTM
LISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDL
GPQNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIDEVGDVGLYFLSDLS
RSVTGEVHHADSGYHVIGMKAVDAPDISVVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagtctggtttgttgcagggcaagcgtggattgattctaggcgtggccaat
aatcgctctatcgcttggggcattgcaaaagccgcccgtgaagctggcgcagagcttgca
ttcacctatcagggtgacgcattgaagaagcgtgtggagccgctggccgaggagcttggc
gccttcgtcgccggacattgcgacgtcgccgatgcggcgagcatcgatgcggtttttgaa
acgcttgagaagaagtggggcaagctcgacttcctggtgcacgcaatcggtttctccgac
aaggacgagctgaccggccgctatatcgatacgtcggaagccaatttcaccaatacgatg
ctgatttcggtctattcgctgacggcggtttcgcgccgcgcggaaaagctgatggccgat
ggcggatcgattctgacgctgacctattacggcgctgaaaaggtcatgccgaattacaat
gtcatgggcgtggccaaggcagcccttgaggcgagcgtgaaatatctggccgtcgatctt
ggcccccagaacattcgcgtcaatgcaatctcggctggccccatcaagacgcttgccgct
tccggcattggtgacttccgctatatcctgaagtggaacgaatataatgcgccgctgcgc
cgcaccgtcacgatcgacgaggtgggtgatgtcggcctttatttcctttcggacctgtcg
cgttcggttacaggcgaagtgcaccatgccgacagcggctatcatgtcattggcatgaaa
gcggttgacgcaccggatatctcggtcgtgaaagactga

DBGET integrated database retrieval system