KEGG   Brucella suis VBI22: BSVBI22_A1072Help
Entry
BSVBI22_A1072     CDS       T01706                                 

Gene name
hisI
Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00340  Histidine metabolism
bsv01100  Metabolic pathways
bsv01110  Biosynthesis of secondary metabolites
bsv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BSVBI22_A1072 (hisI)
Enzymes [BR:bsv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BSVBI22_A1072 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: AEU06082
LinkDB All DBs
Position
I:1046251..1046670
Genome map
AA seq 139 aa AA seqDB search
MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETG
IAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYR
QVVSSGGKVALTMVSDHDQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttcctgcccagccttccgacaagaaggccgttgaagaaggcgcggcattc
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggtaagcgatcacgatcaataa

DBGET integrated database retrieval system