KEGG   Brucella suis VBI22: BSVBI22_A1897Help
Entry
BSVBI22_A1897     CDS       T01706                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00020  Citrate cycle (TCA cycle)
bsv00190  Oxidative phosphorylation
bsv00650  Butanoate metabolism
bsv01100  Metabolic pathways
bsv01110  Biosynthesis of secondary metabolites
bsv01120  Microbial metabolism in diverse environments
bsv01130  Biosynthesis of antibiotics
bsv01200  Carbon metabolism
Module
bsv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSVBI22_A1897 (sdhB)
   00650 Butanoate metabolism
    BSVBI22_A1897 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSVBI22_A1897 (sdhB)
Enzymes [BR:bsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BSVBI22_A1897 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BSVBI22_A1897 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AEU06881
LinkDB All DBs
Position
I:complement(1836845..1837624)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSRMQEGKTWPRPDGATRVTEFRIYRWSPDDDENPRIDTYYVDRDDCGPMVL
DGLLYIKNKIDPTLTLRRSCREGICGSCAMNIDGANTLACTKGMDDIKGTIKVYPLPHMP
VVKDLVPDLNNFYAQHRSIEPWLKTVSPEPQMEWLQSHEDRQKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgcacttcccaagaattcccgtatgcaggagggcaagacctggccccgt
cctgatggcgccacccgtgtcacggaattccgcatctatcgctggtcgccggatgacgac
gaaaatccgcgtatcgatacctattatgtcgatcgtgacgattgtggtccgatggttctg
gacggtctgctctatatcaagaacaagatcgacccgacgctgacgctgcgccgttcgtgc
cgtgaaggcatttgcggttcctgcgccatgaatatcgatggcgcgaacacgcttgcctgc
accaagggtatggacgacatcaagggcaccatcaaggtctatccgctgccgcatatgccg
gtggtgaaggatcttgtgccggacctcaataatttctacgcccagcaccgttccattgag
ccatggctcaagacggtttcgccggagccgcagatggaatggctgcaaagccatgaggac
cgccagaagctcgatggtctttatgagtgcattctgtgcgcctgctgctcgacctcatgc
ccgagctattggtggaacggcgaccgttatcttggccccgccgtgctgcttcaggcctat
cgctggctgatcgattccagagacgaagccaagggcgaacgcctcgataaccttgaggat
ccgttccggctttatcgctgccatacgatcatgaattgcgcccagacctgcccgaagggt
ctgaacccggccaaggcgattgccgaaatcaagaagatgatggtcgaacgccgcgtgtaa

DBGET integrated database retrieval system