KEGG   Brucella suis VBI22: BSVBI22_A1898Help
Entry
BSVBI22_A1898     CDS       T01706                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00020  Citrate cycle (TCA cycle)
bsv00190  Oxidative phosphorylation
bsv00650  Butanoate metabolism
bsv01100  Metabolic pathways
bsv01110  Biosynthesis of secondary metabolites
bsv01120  Microbial metabolism in diverse environments
bsv01130  Biosynthesis of antibiotics
bsv01200  Carbon metabolism
Module
bsv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bsv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSVBI22_A1898 (sdhA)
   00650 Butanoate metabolism
    BSVBI22_A1898 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSVBI22_A1898 (sdhA)
Enzymes [BR:bsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BSVBI22_A1898 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BSVBI22_A1898 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AEU06882
LinkDB All DBs
Position
I:complement(1837640..1839481)
Genome map
AA seq 613 aa AA seqDB search
MASAVNNAAPAAASKYTYVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSH
TVAAQGGIAASLKNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLTREAPAAVYELEHYGVP
FSRTEEGKIYQRPFGGHMQNFGDGPPVQRTCAAADRTGHAILHTLYGQSLKNNAQFFIEY
FALDLIMTDGVCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGM
VARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLAS
RDVVSRCMTMEIRAGRGVGKNKDHIYLHLDHLDPAVLHERLPGISESAKIFAGVDVTKEP
IPVLPTVHYNMGGIPTNYWGEVLNPTKEDPDRVQPGLMAVGEAGCASVHGANRLGSNSLI
DLVVFGRAAAIRAGQVIDRKSKIPDIDIAACDKIMERFDRLRFANGSTPTAVLREKMQRT
MQEDAAVFRTEESLKQGVERMEKLWHELPDIKVTDRSMIWNSDLVETLELENLMANALTT
VVSAEARQESRGAHAREDFPDRNDAEWRKHTLSRLSPDGKVTLDYRSVHLDPLTTEEEGG
ISLAKIAPKKRVY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgcagtaaacaatgcggcgcccgccgctgcaagcaagtacacctatgtcgat
cacaagttcgacgtggtggtggtcggagccggcggcgcgggcttgcgcgcaaccctcggc
atggccgaacagggcctcaagacggcttgtatcaccaaggttttcccgacccgctcgcat
acggttgcggcgcagggcggcatcgccgcttcgctcaagaacatggggccggatagctgg
cagtggcatatgtacgacaccgtgaaagggtcggactggctgggcgataccgacgccatg
gaatatctgacccgcgaagcgcctgccgccgtctacgagcttgagcattacggcgtgccg
ttctcgcgtacggaagaaggcaagatctatcagcgcccctttggcggccacatgcagaat
ttcggcgatggtcctccggttcagcgcacctgcgctgctgccgaccgtaccggccatgcc
atcctgcatacgctttacggccagtcgctgaagaacaatgcgcagttcttcattgaatat
ttcgcgctcgacctcatcatgaccgatggcgtgtgcaccggcgtcgtggcgtggaacctc
gatgacggcacgatccatcgcttctccgccaagatggtggttctggcgacgggcggctat
ggccgcgcctatttctcggcaacctctgcccatacctgcaccggcgacggcggcggcatg
gtggcacgcgccggcctgccgttgcaggacatggaattcgtgcagttccacccgaccggc
atttatggcgcgggctgcctcatcaccgaaggcgcgcgcggcgaaggcggctatctggtc
aattccgaaggcgaacgcttcatggagcgttatgccccctcggccaaggaccttgcctcg
cgagacgttgtttcgcgctgcatgacgatggaaattcgtgcgggccgcggcgtcggcaag
aacaaggaccacatctacctgcatctcgaccatctcgaccctgctgttctgcatgaacgc
ctgccgggcatttccgagtcggccaagattttcgcgggcgtggatgtgaccaaggaaccg
atcccggttctgccgaccgttcactacaatatgggcggcattccgaccaactattggggc
gaagtgctgaacccgaccaaggaagacccggaccgcgtgcagccgggcctgatggccgtg
ggcgaagcgggctgcgcttcggtgcatggcgcaaaccgtctcggctccaactcgctgatc
gatctcgtggtgttcggccgcgcggctgcgatccgcgccggtcaggtcatcgaccgcaag
tcgaagatcccggatatcgatatcgctgcctgtgacaagatcatggaacgcttcgaccgc
ctgcgctttgccaacggctccacgccgacggctgtgctgcgtgaaaagatgcagcgcacc
atgcaggaagatgccgccgtgttccgcacggaggaatcgctcaagcagggtgtcgagcgc
atggaaaagctctggcatgaactgccggacatcaaggtcacagaccgctccatgatctgg
aactcggatctcgttgaaacgctggaacttgaaaatctgatggcgaatgcgctgacgacc
gttgtttcggcggaagcccgtcaggaaagccgcggcgcccatgcgcgcgaggatttcccg
gaccgcaacgacgcggaatggcgcaagcacacgctttcccggctttcgcctgacggcaag
gtcacgctcgactatcgttcggttcatctcgatccgctgacgacggaagaggaaggtggc
atcagcctcgccaagattgcgccgaagaagcgcgtttactga

DBGET integrated database retrieval system