KEGG   Brucella suis VBI22: BSVBI22_A2161Help
Entry
BSVBI22_A2161     CDS       T01706                                 

Gene name
infB
Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
bsv  Brucella suis VBI22
Brite
KEGG Orthology (KO) [BR:bsv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsv03012]
    BSVBI22_A2161 (infB)
   03029 Mitochondrial biogenesis [BR:bsv03029]
    BSVBI22_A2161 (infB)
Translation factors [BR:bsv03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    BSVBI22_A2161 (infB)
 Prokaryotic Type
   BSVBI22_A2161 (infB)
Mitochondrial biogenesis [BR:bsv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BSVBI22_A2161 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2 GTP_EFTU IF2_N MMR_HSR1 IF2_assoc GTP_EFTU_D2 FeoB_N SRPRB Ras PduV-EutP Roc Arf RsgA_GTPase MMR_HSR1_Xtn AIG1
Motif
Other DBs
NCBI-ProteinID: AEU07142
LinkDB All DBs
Position
I:2087122..2090001
Genome map
AA seq 959 aa AA seqDB search
MSDKTNDDKTLSVNPKKTLTLKRPGVEQSTVRQNFSHGRTKAVVVETKKRKFSRPDEKPE
VEAAAAPKPAAPAAAPQQAPASAPVSASAAQASAPQPAPVKAPATKAPAAPSAPVTKPHV
AQQRPVHQRPGGQQAQRPRPADRSGMVLNTLSRSEMDARRRALEEAQIREVEERARAVEE
AKRRAEEDARRAKEREESARRQAEEEARLKAEAEARRKAEEEAAKRMPQPEARSERRDDA
RPAPYGARPQQAGRPQGGRPQPAGRPQQGSPRPAPIIADAAPIAGKPLPQSQLRKPGQSD
DDDDRRSDAARRGVAAKPEVRAPKVVKGEDDRRRGKLTLTSNLEEEGRSRSLSAMRRRQE
KFKRSQMQETREKISREVTIPETITLQELAQRMAERSVDIIKYLMKQGQMMKPGDVIDAD
TAQLIAEEFGHTVKRVAESDVEEGIFDVADNESAMVSRPPVVTIMGHVDHGKTSLLDAIR
HANVVSGEAGGITQHIGAYQVVQNGQKITFIDTPGHAAFTAMRARGAQATDIAILVVAAD
DSVMPQTIESINHAKAAGVPIIVAINKIDKPAADPQKVRTALLQHEVFVESMGGEVLDVE
VSAKNKINLDKLLDAVLLQAEMLDLKADPDRTAEGVVIEAQLDRGRGSVATVLIQKGTLH
PGDILVAGSEWGRVRALVNDRGEHVKEAGPAMPVEILGLQGTPQAGDRFAVVANEAKARE
IAEYRQRLARDKAVARQSGARGSLEQMMNQLQVSGTKEFPLVIKGDVQGSIEAITNALDK
LGTDEVRARIVHSGAGGITESDVSLAEASNAAIIGFNVRANKQARDSAEQQGIEIRYYNI
IYDLIDDVKAAMSGLLSPERRETFLGNAEILEVFNITKVGKVAGCRVTEGKVERGAGVRL
IRDNVVIHEGKLKTLKRFKDEVAEVPSGQECGMAFENYDDIRAGDVIEAFRVEHVSRTL
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataaaacaaacgacgacaagacgctgagcgtcaatccaaagaagacgctaacc
ctgaagcggccgggcgtcgaacagagcaccgtgcgccagaatttcagccacggccgcacg
aaggctgtcgtcgttgaaaccaagaagcgcaaattctctcgcccggatgagaagccggaa
gttgaagccgcggcagcgcccaagcccgcagctccggctgctgctccgcagcaggcaccg
gcatcggcgccagtatcggcgtcggccgcacaggcttccgccccgcagccggcacccgta
aaggccccggcaacgaaggcgcccgcagccccgtctgctccggtaacgaagccgcatgtc
gcgcagcaacgcccggtgcatcagcgccccggcggccagcaggcacagcgtccgcgcccg
gcggatcgttccggcatggtgctgaacacgctgtcgcgctccgaaatggatgcccgccgc
cgcgcgcttgaagaagcgcagatccgcgaagtggaagaacgcgcccgcgctgtcgaggaa
gccaagcgccgcgccgaggaagatgcgcgccgcgccaaggaacgtgaagaatctgcccgt
cgccaggcggaagaggaagcgcgcctgaaagcggaagctgaagcgcgccgcaaggccgag
gaagaagctgccaagcgtatgccgcagccggaagcccgtagcgagcgccgtgacgatgcg
cgccctgcaccatatggtgcacgtccgcagcaggctggccgcccgcaaggtggtcgcccg
cagccggccggaaggccgcagcagggcagcccgcgtccggcccccattattgccgatgcc
gctccgatcgctggcaagccgcttccgcagagccagcttcgcaagcccggccagtccgac
gatgacgacgatcgccgcagtgacgcagcccgccgtggcgtcgcggcaaagccggaagtg
cgcgcaccgaaggttgtgaagggcgaagacgatcgccgtcgcggcaagctcaccctcacg
agcaatcttgaggaagagggccgttcgcgctcgctttccgcgatgcgccgccgtcaggaa
aaattcaagcgctcgcagatgcaggaaacgcgcgagaagatttcgcgtgaagtcaccatt
cctgaaaccatcacgcttcaggaactggcacagcgcatggccgagcgttccgtggacatc
atcaagtacctgatgaagcagggccagatgatgaagccgggcgacgtgatcgatgccgat
accgcgcagctcattgccgaggaattcggccatactgtcaagcgcgttgctgaatcggac
gtggaagaaggcatcttcgacgttgccgacaacgaatccgcaatggtttcgcgtccgccg
gtcgtgaccatcatgggtcacgttgaccacggcaagacctcgcttctcgacgccatccgc
cacgccaatgtcgtttccggcgaagcgggcggcatcacgcagcatatcggcgcctatcag
gtcgtacagaacggccagaagatcaccttcatcgatacgccgggccacgccgcctttacg
gcaatgcgtgcccgtggcgcacaggcaaccgatattgccattctggtggttgcggctgat
gacagcgtcatgccgcagacgattgaatccatcaatcacgccaaggcagccggtgttccg
atcatcgttgcgatcaacaagatcgacaagcctgcggccgacccgcagaaggtgcgcacc
gcactgttgcagcacgaagtcttcgtggaatcgatgggcggtgaagtgctcgacgtcgaa
gtgtcggccaagaacaagatcaatctggacaagctgctcgatgccgttctgcttcaggct
gaaatgctcgatctgaaggccgatccggaccgtaccgcggaaggtgtggtcatcgaagcc
cagctcgatcgcggtcgtggttcggttgccaccgttctcatccagaagggcacgctgcat
cccggcgatattctggtggcgggcagtgaatggggtcgcgtgcgcgccctcgtcaatgac
cgtggcgagcatgtgaaggaagctggtcctgcaatgccggtggaaatcctcggccttcag
ggcacgccgcaggcgggcgaccgtttcgcagtcgtggccaatgaagccaaggcccgtgaa
atcgcggaatatcgtcagcgtctggcgcgcgacaaggccgttgcacgccaatccggtgcg
cgcggttcgctggagcagatgatgaaccagttgcaggtgtcgggcacgaaggaattcccg
ctcgtcatcaagggcgacgtgcagggctccatcgaagcgatcaccaacgcgctggacaag
ctgggcaccgacgaagtgcgcgcgcgcatcgtccattcgggcgcgggcggcatcacggaa
agcgacgtatcgctggccgaagcctccaatgccgcgatcatcggcttcaacgttcgtgcc
aacaagcaggcgcgggattctgccgagcagcagggtatcgaaatccgctactacaacatc
atctatgatctcatcgatgacgttaaagcggccatgtcgggccttctgtcgccggaacgc
cgtgaaaccttccttggcaatgcggagattctcgaagtcttcaacatcaccaaggttggc
aaggtggccggttgccgcgtcaccgaaggcaaggtcgagcgtggtgcaggcgttcgcctc
atccgcgacaacgtggtcatccacgaaggcaagctcaagacgctcaagcgcttcaaggat
gaagtcgccgaagtgccgagcggccaggaatgcggtatggcgttcgagaactacgacgat
attcgcgcaggcgacgtcatcgaagctttccgcgtcgaacacgtttcgcgtacgctctag

DBGET integrated database retrieval system