KEGG   Brucella suis VBI22: BSVBI22_B0914Help
Entry
BSVBI22_B0914     CDS       T01706                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsv  Brucella suis VBI22
Pathway
bsv00473  D-Alanine metabolism
bsv01100  Metabolic pathways
bsv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsv00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSVBI22_B0914 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BSVBI22_B0914 (alr)
Enzymes [BR:bsv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSVBI22_B0914 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bsv01011]
 Precursor biosynthesis
  Racemase
   BSVBI22_B0914 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEU08042
LinkDB All DBs
Position
II:908456..909646
Genome map
AA seq 396 aa AA seqDB search
MSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPA
FYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVE
NWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDE
PGNAANARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHD
FSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYA
DGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLED
VARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcatattgaccatt
gatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgccccaacccgt
acggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtcgcaccggct
ttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagcagtggcgctg
aagccctttttgaaacctgacgcaacactttatgtcctgaacggccttcagcccggaacg
gaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaacaggttgaa
aactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctccagttcgat
accggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttcttgagaacgtc
acgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaacggcgacgag
ccgggaaatgcggcaaatgcccgtcagcttgccaagatgacggccttgctcgctcgcctg
ccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaagacctattat
ttcgatctcgcccgccccggcatcgcgctatatggcatcgatccggagaggcagcatgac
ttttcggataaggtggcgcacgagaataagaaacccaagcattcgatccttcccgtcctc
accctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgacagttggctat
ggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtcggctatgct
gacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgatacgcgcctg
cccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctcattgccggag
ggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagcgcctcgaagac
gtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggcaaccgttat
gcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system