KEGG   Brucella suis ZW043: IY71_05950Help
Entry
IY71_05950        CDS       T03426                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00730  Thiamine metabolism
bsw00790  Folate biosynthesis
bsw01100  Metabolic pathways
bsw02020  Two-component system
Module
bsw_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    IY71_05950
   00790 Folate biosynthesis
    IY71_05950
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IY71_05950
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsw04147]
    IY71_05950
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsw00537]
    IY71_05950
Enzymes [BR:bsw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     IY71_05950
Exosome [BR:bsw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IY71_05950
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bsw00537]
 Enzymes
  IY71_05950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase DUF5300
Motif
Other DBs
NCBI-ProteinID: AIN84418
UniProt: A0A2D2BPM6
LinkDB All DBs
Position
1:1194028..1195473
Genome map
AA seq 481 aa AA seqDB search
MPRKFTRPLLASAAIIVTFCAPASTVMAQSETAAPLFQRSAKGDLSAAGGARRLDGDITA
AFRDQIRKGPARNVILLIGDGMGDSEITVARNYAVGAGNHFKGIDALPVTGQYTHYSLDK
ESGKPNYVTDSAASGTAWATGVKTYNGAIGVDIHGKPHKTLIELAKEKGLGTGNVSTAEL
QDATPAVQVAHVTHRKCYDPTSTAEKCKDNALENGGPGSISEQLLNTRPDVTLGGGAKYF
EDKARAGTWKGQTLSAQAEARGYQLVRNADTLSKVETANQDKPVLGLFSPGNMPVRWKGP
QAAHHGNLDREPVKCKVNEKRTADIPTLAQMTEKAIDLLKTNEKGFFLQVEGASIDKQDH
AANPCGQIGETVDLDEAVQAALDFARKDGNTLVIVTADHAHASQIIDPDAKAPGLSQALK
TEDGAIMGVTYGNSDEADDQGHTGAQLRIAAFGPGAANFTGLTDQTDMFYTIRDALQLQA
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaaattcacccggccacttctggcaagcgctgcaattattgtcaccttttgc
gcacccgcaagcaccgtgatggcccagtctgaaactgcggctccactcttccagcgcagc
gcaaaaggcgacctgtcggcagcaggcggcgcacgccgccttgatggtgatattaccgca
gcttttcgcgatcagatcaggaaggggcctgccagaaacgtcatcctgctgatcggagac
ggcatgggcgattccgagatcacggttgcgcgcaattatgcagtcggcgcaggcaatcat
ttcaagggcatcgatgcccttcccgttaccggccagtacacccattattcgctcgacaag
gaaagcggcaagccgaattacgtgactgattctgccgcctccggcaccgcctgggccact
ggcgtcaaaacctataacggcgccatcggcgtcgatattcatggcaaaccgcacaaaacg
ctcattgaactcgccaaggaaaagggcctcggcaccggcaatgtcagcactgccgaattg
caggatgccacacccgccgtgcaggttgcccatgttacccatcgcaagtgctacgaccca
accagcacggcggaaaagtgcaaggataatgcgcttgaaaatggcggcccaggctcgatc
agcgaacagcttttgaacacccgcccggacgtgacattgggcggcggcgcaaaatatttc
gaggacaaggcccgggctggcacatggaaaggccagaccttgagcgcacaggccgaagca
cgcggctatcaactggttagaaatgccgacacattgagcaaggtcgagacagccaatcag
gacaaacctgttctcggcctcttctcaccgggcaacatgccggtccgctggaaagggcct
caggccgcccatcacggcaatctcgacagagagcctgtcaagtgcaaggtcaatgagaag
cgcactgccgatattccgacactggcgcaaatgaccgagaaagccatcgacctgctgaaa
accaacgaaaaaggctttttccttcaggtggaaggtgcctccatcgacaaacaggaccat
gccgccaatccgtgcgggcagatcggcgaaacagtcgatctggatgaagccgtgcaggcc
gcactcgattttgcccgcaaagacggcaacacgcttgtcatcgtaacggccgatcacgcc
catgcaagccagatcattgatcccgatgcgaaggctccgggtttgagccaggcattgaaa
accgaggatggcgcgatcatgggcgtgacctatggcaattccgacgaagccgacgatcag
ggccacacaggcgcgcaattgcgcatagccgcctttggccccggcgctgccaattttacc
ggcctcacggatcagacggatatgttctacacgatccgcgatgccttgcagttgcaggcg
gaataa

DBGET integrated database retrieval system