KEGG   Brucella suis ZW043: IY71_06300Help
Entry
IY71_06300        CDS       T03426                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00473  D-Alanine metabolism
bsw00550  Peptidoglycan biosynthesis
bsw01100  Metabolic pathways
bsw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    IY71_06300
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IY71_06300
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    IY71_06300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsw01011]
    IY71_06300
Enzymes [BR:bsw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     IY71_06300
Peptidoglycan biosynthesis and degradation proteins [BR:bsw01011]
 Precursor biosynthesis
  Amino acid ligase
   IY71_06300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIN84479
UniProt: A0A4Z0EZY3
LinkDB All DBs
Position
1:complement(1250832..1251893)
Genome map
AA seq 353 aa AA seqDB search
MASGKMRIVVLFGGRSAEHDVSVLSATNVMNALDPAKYEAVPVFVTRAGQWLLSRFVNGA
LEKPSSGAELCLVPGGCGRAIVVPDAGAPYEADKIDIIFPVLHGLHGEDGAVQGLAQVAR
VPLAGCGIPGSANALDKDIAKRLVNEAGLSTAKSVTITREEVPAFSALEQALGLPIFIKP
ARQGSSVGVHKVVTEADYQAAMSDGFTYDDKLLAEEFIQAREVECGVLEDEGGALFVSRA
GEIVPAESHCFYSYDAKYIDADGTEIKVPAELPEQVENEIRAIATRAFRVLGCDSMARVD
FFVTADRRIVLNEINTIPGFTDMSMYSKVMAVSGVSYPEIINRLVAHGLARGS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggaaaaatgcgtatcgttgtcctctttggtggacgctcagcggagcatgat
gtttccgttctttcagcaaccaatgtcatgaatgcgctggatccggccaaatatgaggct
gttcctgtttttgtaacacgcgcgggacaatggctgttgagccgcttcgtgaacggtgcg
ctggaaaagccgtcaagcggcgcagagctttgccttgttccgggcggctgtgggcgtgcc
atcgtggttcctgatgccggcgctccatacgaggcggacaaaatagatatcatatttccg
gttctgcatggccttcatggggaagatggtgctgtgcaaggcttggctcaggttgcgcga
gtaccgctggcaggttgtggtattccaggttccgccaatgcactcgacaaggatattgcc
aagcgcctggtcaatgaagcgggcctgtccacggcaaaatccgtgaccatcacgcgcgaa
gaggttcccgctttcagtgcgctcgaacaggctttgggtttgcccatatttatcaaaccc
gcccgtcagggttcgtctgtcggtgtccacaaggttgtaacggaagcagattatcaggct
gccatgtccgatggtttcacttatgacgataagctgctggctgaagagttcattcaggcg
cgcgaagttgaatgcggcgttcttgaagacgaaggaggcgcgctgttcgtctcgcgcgct
ggcgagattgtgcctgcggaaagccactgtttttatagttatgatgccaaatatatcgat
gccgatggaactgagatcaaggttcctgcggagttgcccgaacaggtagagaatgaaatc
cgtgcgatcgccaccagggctttccgggttctgggctgcgattccatggcgagggttgat
ttttttgttacggcagacaggcgtatcgtgctgaatgaaatcaacactattcccggcttc
accgatatgagcatgtattccaaggtgatggctgtgagcggtgtaagctatcctgaaatt
atcaatcgattggttgcgcatggcttggcgcggggaagctga

DBGET integrated database retrieval system