KEGG   Brucella suis ZW043: IY71_10255Help
Entry
IY71_10255        CDS       T03426                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bsw  Brucella suis ZW043
Pathway
bsw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsw01100  Metabolic pathways
bsw01110  Biosynthesis of secondary metabolites
bsw01130  Biosynthesis of antibiotics
bsw01230  Biosynthesis of amino acids
Module
bsw_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bsw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IY71_10255
Enzymes [BR:bsw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     IY71_10255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 RsgA_GTPase AAA_30 TsaE AAA_22 AAA APS_kinase 6PF2K AAA_17 SRP54 AAA_5 DUF815 ABC_tran AAA_16
Motif
Other DBs
NCBI-ProteinID: AIN85183
UniProt: A0A4Z0F625
LinkDB All DBs
Position
1:complement(2038375..2038977)
Genome map
AA seq 200 aa AA seqDB search
MSGTNKQTNLHRQTETIRQLLGSKVVVLVGLMGAGKSTIGRKVANMLNLPFKDADTEIET
VSRMTVAELFEAYGEVEFRDLERRVILRLLDDGPMVLATGGGAYMNAETRAAIAEAGISI
WINADLDVLMERVSRRQNRPLLRNSDPRGVMQRLMDERYPVYALAELHLMTRDEKKEVIA
AELIEVLAAHLEKEQAASAG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtacgaacaaacaaacaaatcttcacaggcagacggaaacgatccgccagctg
ctcggcagtaaagtggttgttctcgttggcctgatgggagccggaaaatccaccatcggc
cgcaaggtggcgaacatgctcaacctgccgttcaaggatgcggatacggaaattgaaact
gtttcgcggatgactgttgccgaactgttcgaggcctatggggaagtggaatttcgcgat
ctcgaacgtcgcgtgatcctgcgccttctcgatgacggccccatggtgctggcgaccggc
ggcggcgcctatatgaacgccgaaacccgcgcggcgattgccgaagcggggatttccatc
tggattaatgccgatctcgacgtcttgatggagcgcgtttcgcgccgccagaaccgtccc
cttttgagaaacagcgatccgcgcggcgtcatgcagcggctgatggacgagcgctacccg
gtttatgcgctggccgagctgcatctgatgacgcgcgatgagaaaaaggaagtgattgcc
gcagaactgatcgaggttctggcggcgcatctggaaaaggaacaggccgcttccgccgga
tga

DBGET integrated database retrieval system