KEGG   Bacillus subtilis XF-1: C663_0072Help
Entry
C663_0072         CDS       T02459                                 

Gene name
hslO
Definition
(GenBank) Hsp33-like chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsx03110]
    C663_0072 (hslO)
Chaperones and folding catalysts [BR:bsx03110]
 Heat shock proteins
  HSP33
   C663_0072 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AGE61938
UniProt: M4KMK2
LinkDB All DBs
Structure
PDB: 

Position
81118..81993
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRTMTAALMLGAMLKGDD
KLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKLDVRRAVGTNGTLSVVK
DLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLVNPDNTILAAGGFIIQLM
PGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEKPEILETMPVRFHCPCSKE
RFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEELEGLRDQTTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagtaaaagcacttgcgtatgacggaaaagttcgggcttatgctgcgaga
acgactgatatggtaaatgagggacagagacgccatggtacgtggccgacagcatccgct
gcattgggccgcacaatgacagctgcacttatgctcggcgctatgctgaagggcgatgat
aagctgaccgtgaaaatcgagggcggaggtccgatcggagctattgtagctgatgccaat
gccaaaggagaagtcagagcctatgtctctaacccgcaagttcattttgatttaaatgaa
caaggcaagcttgatgtcagacgtgcggttggaacaaacggaacgttaagtgtcgtaaaa
gatttaggtttgcgcgagttcttcacaggacaagtagaaatcgtttcaggagaattagga
gatgatttcacttactatcttgtctcatctgagcaggttccttcatcagtgggtgtaggt
gtgctcgtgaatcctgacaataccattcttgcggcagggggctttattattcagctgatg
ccgggaacagatgatgaaacaatcacaaaaattgaacagcgtctatctcaagtagagccg
atttctaagctcatccaaaaagggctgacaccagaagaaattttagaagaagtcctaggt
gagaaacctgagattttggaaacgatgcctgtcagattccattgcccttgttcaaaagaa
cggttcgaaacagccattttaggactaggcaaaaaagaaattcaagatatgatagaagaa
gatggacaagccgaagcagtatgccatttttgtaatgaaaagtacttatttacaaaagaa
gagctggaagggcttcgtgaccaaactacccgctaa

DBGET integrated database retrieval system