KEGG   Bacillus subtilis XF-1: C663_0323Help
Entry
C663_0323         CDS       T02459                                 

Gene name
nasA
Definition
(GenBank) nitrate transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    C663_0323 (nasA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsx02000]
    C663_0323 (nasA)
Transporters [BR:bsx02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    C663_0323 (nasA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 LacY_symp MFS_2
Motif
Other DBs
NCBI-ProteinID: AGE62180
UniProt: M4KPG4
LinkDB All DBs
Position
356113..357276
Genome map
AA seq 387 aa AA seqDB search
MLCSFLYFDVSFMIWVMLGALGVYISQDFGLSPFEKGLVVAVPILSGSVFRIILGILTDR
IGPKKTAVIGMLVTMIPLLWGTFGGRSLTELYAIGILLGVAGASFAVALPMASRWYPPHL
QGLAMGIAGAGNSGTLFATLFGPRLAEQFGWHIVMGIALIPLLIVFILFVSMAKDSPAQP
SPQPLKSYLHVFGQKETWFFCLLYSVTFGGFVGLSSFLSIFFVDQYQLSKIHAGDFVTLC
VAAGSFFRPVGGLISDRVGGTKVLSVLFVIVALCMAGVSSLPSLSMVIVLLFVGMMGLGM
GNGAVFQLVPQRFRKEIGMVTGIVGAAGGIGGFFLPNILGSLKQMTGTYAIGFITFSCIA
LLAFALVLAAGYYWRKSWSAESSPADV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgctctgttcctttttatactttgatgtcagttttatgatatgggttatgcttggggcg
ctgggtgtttatatttctcaggattttggcctgtctccttttgagaaagggcttgtcgta
gctgtgccgattttatctggatcagtgtttcgtatcattcttggtattttaacggacaga
atcggaccgaaaaaaacggcagtgatcgggatgctggtgacgatgattccgctgctttgg
gggacattcggcggccgttccctgactgaactgtatgccatcgggattctgcttggcgtg
gcgggggcaagctttgctgtagcgctgcctatggccagccgctggtatcctcctcatttg
cagggacttgcgatggggattgctggagcggggaacagcggcacgttgtttgcaaccctg
tttggccctcgtctggcagagcagttcggctggcacattgtcatgggaattgcgcttatt
ccattattgatcgtctttattctttttgtatccatggcaaaggattctcctgcacagccg
tctccgcagccgctcaaaagctatctgcatgtgttcgggcaaaaggaaacatggtttttc
tgcctgctgtacagcgtcacatttggcggatttgtcgggctctcaagctttttatcaatt
ttctttgttgatcaataccagctgtcaaaaattcacgcgggcgacttcgttacattatgt
gtggcggcggggagctttttccggcctgtcgggggcttgatttcggatcgtgtcggcggc
acgaaagttctttctgtactgtttgtcatcgtggcactgtgtatggccggagtcagcagc
ctgccatctctttcaatggttattgttctattgtttgtcggaatgatggggctcggaatg
ggtaacggtgcagtattccagctcgtgccgcagcgttttcgcaaagaaattggcatggtg
acgggaatcgtcggtgcggccggaggaatcggagggtttttcctgccgaacatcttagga
tctctcaaacagatgacaggcacatatgctatcggttttatcacgttttcctgtatcgcg
ctgctggcgtttgcacttgtccttgccgcaggctattactggcggaaaagctggagcgcg
gaaagcagcccggcggatgtttag

DBGET integrated database retrieval system