KEGG   Bacillus subtilis XF-1: C663_0327Help
Entry
C663_0327         CDS       T02459                                 

Gene name
yckA
Definition
(GenBank) putative ABC transporter
  KO
K10009  L-cystine transport system permease protein
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    C663_0327 (yckA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsx02000]
    C663_0327 (yckA)
Transporters [BR:bsx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    C663_0327 (yckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGE62184
UniProt: M4KUU6
LinkDB All DBs
Position
complement(360563..361243)
Genome map
AA seq 226 aa AA seqDB search
MISSIQWEYIFNTKLAIESFPYVIKGIGYTLLISFVSMFAGTVIGLFISLARMSKLALLR
WPAKLYISFMRGVPILVILFILYFGFPYIGIEFSAVTAALIGFSLNSAAYIAEINRSAIS
SVEKGQWEAASSLGLSYWQTMRGIILPQSIRIALPPLANVLLDLIKASSLAAMITVPELL
QHAKIIGGREFDYMTMYILTALIYWAICSIAAVFQNILEKKYAHYV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgattagtagcattcaatgggaatatattttcaacacgaagctggctattgaatcgttc
ccttatgtcataaaaggcattgggtatacactgctcatctcttttgtaagcatgtttgcg
ggaactgtgatcggcctgtttatatcactcgccagaatgtctaaacttgctttgttaaga
tggccggcgaagctctatatctcatttatgcggggcgttccgattttggtgattttgttt
atcctttatttcgggtttccttatatcggcattgaattttccgctgtcacggctgcttta
atcgggtttagcctaaacagcgccgcctacattgcggaaattaaccgttcagccatttca
tccgtcgaaaaagggcagtgggaagccgcatcctcgctgggtctttcctattggcagacg
atgaggggcatcattttgccgcaatcgatacgtattgcgctgcctccgcttgccaatgta
ttgctcgacttaatcaaggcgtcctctctcgctgcgatgattacagtgccggaattgctc
cagcatgcgaaaatcatcgggggcagagagtttgattatatgaccatgtatattctgacc
gctctcatttattgggccatctgctccattgccgcggtctttcagaatatccttgagaaa
aaatacgctcattatgtttaa

DBGET integrated database retrieval system