KEGG   Bacillus subtilis XF-1: C663_0360Help
Entry
C663_0360         CDS       T02459                                 

Definition
(GenBank) hypothetical protein
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C663_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-ProteinID: AGE62217
UniProt: M4KMY9
LinkDB All DBs
Position
complement(409516..410871)
Genome map
AA seq 451 aa AA seqDB search
MRAILLYYLYTETVNGGLGFDKGTAVAIMSIYGSLVYMSTIIGGWLADRVFGTANTVFYG
GIFIMFGHIALAYPGSAIAFYISMVLIIVGTGLLKPNVSSVVGDLYTKEDPRRDSGFSIF
YMGINLGGLLAPLIVGTLGQKYNYHLGFGAAAVGMLLGLIVFALTRKKNLGLAGSNVPNP
LSKKSAIGTGIGVIIVAIAVIISVQTGVLTINRFIDLVSILGILIPVIYFIIMFTSKKAD
STEKSRLAAYVPLFIGAVMFWAIQEQGATILAVYADERIRLSLGGFELQSSWFQSLNPLF
VVIFAPIFAWLWMKLGKRQPSTPVKFSIGIILAGLSFIIMVFPAMQGKEALVSPLWLVLS
FLLVVLGELCLSPVGLSVTTKLAPAAFSAQTMSMWFLTNAAAQAINAQVAGLFDKIPETM
YFGTIGLISIVLGGILLLLSPMIKRAMKGVL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatcttactttactatttgtatacagagacggtaaacggagggctcggcttt
gataagggcactgcggttgccattatgtcgatttacggatcactcgtatacatgtccacc
attattggcggatggctcgctgaccgggtattcggtaccgcaaacaccgtgttttacggc
ggcatattcattatgttcggccacattgcactcgcctatccgggcagcgcgatcgcattc
tatatcagcatggtgcttattattgtcggaacaggcttattaaaaccaaacgtttcaagc
gtggttggggatctttacacgaaagaagacccgcgccgcgactcaggtttcagtattttc
tacatggggattaacctcggtggtttacttgcgccattaattgtcggaacactcggacag
aagtacaactatcatctcggcttcggagctgccgcagtcggaatgcttctcggacttatc
gtatttgctttgacaaggaagaaaaacctcgggcttgcaggttccaatgtgccaaatccg
ctgtctaaaaaatctgcgattggcaccggaatcggtgttatcatcgtggcgatcgcagtg
attatctctgtacaaacaggcgtgctgacgatcaatcgttttatcgaccttgtaagtatt
ctcggtattttgattcctgtcatttatttcatcatcatgtttacaagcaaaaaagcggac
agcacagaaaaatcccgtcttgccgcttacgttcctttgtttatcggtgctgtcatgttc
tgggccattcaggaacagggggcgaccattcttgcggtatacgctgatgaacgcattaga
ctttcattgggcggattcgaacttcagtcatcatggttccaatcattaaatccattgttt
gttgtcatttttgcgccaatattcgcatggctctggatgaagcttggcaaacgccagccg
tctacaccagttaaattctcaatcggaattattttagccggattgtcttttatcattatg
gtattccctgctatgcaaggaaaagaagcactcgtaagcccgctttggctcgttctcagc
ttcctgcttgtcgtgcttggagagctgtgcctgtctccagtcggtttatccgtaacaacg
aaactggcgccagctgcattctctgcacagacaatgagtatgtggtttctgactaacgca
gcagcccaagcgatcaatgcccaagtagccggattgtttgataaaattcctgaaacaatg
tacttcggcaccatcggtttgatttctatcgttcttggcggcattctcctgctgctctcg
ccgatgatcaaacgcgcgatgaaaggggtcttataa

DBGET integrated database retrieval system