KEGG   Bacillus subtilis XF-1: C663_0368Help
Entry
C663_0368         CDS       T02459                                 

Gene name
yclJ
Definition
(GenBank) two-component response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsx02022]
    C663_0368 (yclJ)
Two-component system [BR:bsx02022]
 OmpR family
  Unclassified
   C663_0368 (yclJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg GerE
Motif
Other DBs
NCBI-ProteinID: AGE62225
UniProt: M4KPK3
LinkDB All DBs
Position
419744..420541
Genome map
AA seq 265 aa AA seqDB search
MNNLFLVDEIKTNNCETQNLLFKMVLLYKKASKQPEDIMKILMIEDNVSVCTMTEMFFFK
EGFEAEFVHDGLEGYQRFTEENWDLIILDIMLPSMDGVTICRKIRETSTVPIIMLTAKDT
ESDQVIGFEMGADDYVTKPFSPLTLVARIKAVIRRYKATGKAVIDEDMIESECFTINKKT
REVLLNGEPVENLTPKEFDLLYYLVQNPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRL
RKKLASEDKPFLYTVWGVGYKFDED
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatctatttctagttgatgaaataaaaactaacaattgtgaaacgcaaaacctt
ctgtttaaaatggtgctattatataaaaaagcatcaaaacaaccggaggatataatgaaa
atattaatgatagaagataatgttagtgtatgtacgatgacggagatgttcttttttaaa
gaaggttttgaagcggaattcgttcatgacgggttagaagggtaccagcgttttacggaa
gaaaattgggatctgatcattttggatatcatgcttccatctatggacggcgtgaccatc
tgcagaaaaataagagagacaagcacggtgccgattatcatgctgactgccaaagacact
gaatcagatcaggtcatcgggtttgagatgggggcggacgattatgtcacaaagccgttc
agcccgctgacattggttgcccgcatcaaagccgtcatcagaagatacaaggcgacaggc
aaagctgttattgatgaagatatgatcgaatcagaatgctttaccattaataagaagacg
agagaagtattattaaacggagagcctgtagaaaatctcacgccgaaggaattcgatctg
ctttattaccttgtccaaaatccgcggcaggtgttctccagagaacagctgctcgagcag
gtatggggctatcaattttatggagatgaacgaacggttgacgttcatatcaaacggcta
aggaaaaagcttgccagcgaggacaagcctttcctgtatactgtttggggagtagggtat
aaatttgatgaagattaa

DBGET integrated database retrieval system