KEGG   Bacillus subtilis XF-1: C663_0462Help
Entry
C663_0462         CDS       T02459                                 

Gene name
alr1
Definition
(GenBank) D-alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00473  D-Alanine metabolism
bsx01100  Metabolic pathways
bsx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C663_0462 (alr1)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C663_0462 (alr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsx01011]
    C663_0462 (alr1)
Enzymes [BR:bsx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     C663_0462 (alr1)
Peptidoglycan biosynthesis and degradation proteins [BR:bsx01011]
 Precursor biosynthesis
  Racemase
   C663_0462 (alr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGE62317
UniProt: M4KN83
LinkDB All DBs
Position
510714..511883
Genome map
AA seq 389 aa AA seqDB search
MSTKPFYRDTWAEIDLSAIKENISNMKKHIGEHVHLMAVVKANAYGHGDAETAKAALEAG
ASCLAVAILDEAISLRKKGLKAPILVLGVVPPEYVAIAAEYDVTLTGYSVEWLQEAARHT
KKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKGVFTHFATADEKERGYFL
MQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADISDEIPF
QLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTDILV
KGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVACT
ISSRVPRMFLENGSIMEVRNPLLQVNTSN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaaacctttttacagagatacgtgggcggaaattgacttgtccgcgataaag
gaaaatatcagcaatatgaaaaaacatatcggtgaacatgtccacttgatggcagttgtg
aaagcaaacgcctacgggcatggtgatgcagaaacagcaaaggctgctcttgaggcaggt
gcttcatgcttggccgtggccattttggatgaagcgatttcactgcgcaaaaagggcttg
aaggcgcctatattggtgcttggcgtggttcccccggagtatgtggcaatcgctgctgag
tatgacgtgaccttaacaggttattctgttgaatggcttcaggaggcagcccgccacacg
aaaaaaggttctcttcattttcatctgaaggtcgatacggggatgaacaggcttggtgta
aaaacagaggaagaagttcagaacgtgatggcaattcttgaccgcaaccctcgtttaaag
tgtaaaggggtatttacccattttgcgacagcggatgaaaaagaaagaggctatttctta
atgcaatttgagcgttttaaagagctgattgctccgctgccgttaaagaatctgatggtc
cactgcgcgaacagcgccgccggactccggctgaaaaaaggcttttttaatgcagtcaga
ttcggcatcggcatgtatggccttcgcccgtctgctgacatttcggacgagataccgttt
cagctgcgtccggcatttaccctgcattcgacgttgtcacatgtcaaactgattagaaaa
ggcgagagcgtcagctacggagccgagtacacagcagaaaaagatacatggatcgggacg
gtgcctgtaggctatgcggacgggtggctccgaaaattgaaagggaccgacatccttgtg
aagggaaaacgcctgaaaattgccggccgaatttgcatggaccaatttatggtggagctg
gatcaggaatatccgccgggcacaaaagtcacattaataggccggcagggggatgaatat
atttccatggatgagattgcaggaaggctcgaaaccattaactatgaggtggcctgtaca
ataagttcccgtgttccccgtatgtttttggaaaatgggagtataatggaagtaagaaat
cctttattgcaggtaaatacaagcaattaa

DBGET integrated database retrieval system