KEGG   Bacillus subtilis XF-1: C663_0691Help
Entry
C663_0691         CDS       T02459                                 

Gene name
gatC
Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00970  Aminoacyl-tRNA biosynthesis
bsx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C663_0691 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsx03029]
    C663_0691 (gatC)
Enzymes [BR:bsx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C663_0691 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C663_0691 (gatC)
Mitochondrial biogenesis [BR:bsx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C663_0691 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AGE62534
UniProt: M4KVV5
LinkDB All DBs
Position
744502..744807
Genome map
AA seq 101 aa AA seqDB search
MEVDHMSRISIEEVKHVAHLARLAITEEEARMFTEQLDSIISFAEELNEVNTDNVEPTTH
VLKMKNVMREDEAGKGLPVEDVMKNAPDHKDGYIRVPSILD
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtggatcatatgtcacgaatatcaatagaagaagtaaagcacgttgcacacctt
gcaagacttgcgattactgaagaagaagcaagaatgttcactgaacagctcgacagtatc
atttcatttgccgaggagcttaatgaggttaacacagacaatgtggagcctacaactcac
gtgctgaaaatgaaaaatgtcatgagagaagatgaagcgggtaaaggtcttccggttgag
gatgtcatgaaaaatgcgcctgaccataaagacggctatattcgtgtgccatcaattctg
gactaa

DBGET integrated database retrieval system