KEGG   Bacillus subtilis XF-1: C663_0761Help
Entry
C663_0761         CDS       T02459                                 

Gene name
yfmT
Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00627  Aminobenzoate degradation
bsx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    C663_0761 (yfmT)
Enzymes [BR:bsx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     C663_0761 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGE62603
UniProt: M4KPC9
LinkDB All DBs
Position
822009..823475
Genome map
AA seq 488 aa AA seqDB search
MLTMFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALA
KKKWDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIMKEAA
TFPIRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLK
PHEETPICGGTLIAKIFENAGIPEGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGS
YIGQLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHS
SIYDKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGG
FNGTIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSN
LERGVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQ
HEKRSFPY
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccatgtttcaatatgaagagttgaataaacagtttatcggcgggaaatggcag
gagggcagcagcccaaatgtattggaaaacaaaaatccttatactcaaaaaacattcaca
acattccgtaaagcgactgctgacgatgtagatgaagcgtatcgggcagcggcgctggca
aagaaaaaatgggatgcggtcaacccgtttgagaaaagaaccattttagaaaaagccgtc
acgtatattgaagaaaatgaagaagctattatttatttgattatggaggagctaggcggt
acaaggctcaaagcggcttttgaaatcggacttgtcaaaaacatcatgaaagaagcggca
acgttcccaatccgcatggaggggaaaattcttccgtccacaatagatggcaaggaaaac
agattatatcgcgtgccggcaggcgttgtcggtgtcatcagtccgtttaacttcccattc
tttttatctatgaaatcagtggcgcctgcactcggagccggcaatggcgttgtgctaaag
ccgcatgaggaaacgccgatttgcggcggaacgctgattgcgaaaatttttgagaacgcg
ggaattccagagggactgctgaatgttgttgtcacagacattgctgaaatcggcgacagc
ttcgttgagcatccagtgccgcggatcatctcatttaccggttctacgaaagtcggcagc
tacatcggacagcttgcgatgaagcattttaaaaagccgcttcttgagcttggcgggaac
agcgccttcatcgtgctagaggatgcagatatagaatatgcggtcaatgcggcggtgttc
agccgatttacacatcaaggacagatttgcatgtcagccaaccgcgtgcttgttcattct
tctatttatgacaaattccttgagctgtaccaggcaaaagtggaatcgctgaaagtcggc
gacccaatggatcctgatacgattatcgggccattaatcaacagcagacagacggacggg
ctgatgaagactgttgagcaagcaattgaagaaggcgctgtaccagtgaagcttggcggt
tttaatgggacgatcgtggaaccgacgattttaaaagacgtcaaaccgttcatgagcatt
gccaaggaagagctgttcggaccagtcgtctcctttatgaagtttgattcagaagacgaa
gcggtggatatcgcaaacgaaaccccgtttggcttgagcggtgccgttcatacgtcaaat
cttgagcgcggcgtggcttttgcgaaacgcattgaaacaggcatgattcacgtcaatgac
acgaccatcaatgatgaaccgaatgtagccttcggcggtgaaaagcaatcaggcctcggc
cgtttaaacggtgagtggagcctcgaagaatttacaacgctgaaatggatctcggtccag
cacgaaaaacgcagcttcccttattaa

DBGET integrated database retrieval system