KEGG   Bacillus subtilis XF-1: C663_0929
Entry
C663_0929         CDS       T02459                                 

Name
(GenBank) hypothetical protein
Organism
bsx  Bacillus subtilis XF-1
SSDB
Other DBs
NCBI-ProteinID: AGE62764
UniProt: M4KWI2
LinkDB
Position
983399..983554
AA seq 51 aa
MKKANPFTHAGLPFLLFPSIMFLSNKSMEYVVFHLDLVYYVTHTPRVFSGR
NT seq 156 nt   +upstreamnt  +downstreamnt
atgaaaaaggcaaatccgtttactcatgcgggtttgccttttttgctgtttccatcaatt
atgtttttatcaaataaatccatggaatatgttgtattccatcttgatctagtgtactat
gttactcatacaccgagggttttttccgggaggtaa

DBGET integrated database retrieval system