KEGG   Bacillus subtilis XF-1: C663_0993
Entry
C663_0993         CDS       T02459                                 
Name
(GenBank) hypothetical protein
Organism
bsx  Bacillus subtilis XF-1
SSDB
Other DBs
NCBI-ProteinID: AGE62823
UniProt: M4KPY9
LinkDB
Position
1049634..1049984
AA seq 116 aa
MIDNKRFCLYDDKKMKSEWKEGLLCQGIYVFIKQFHIGAANLLFCFRERFFRSDRALKSA
VRNISVKKGMELTLHAFFIYKIYGKTGVWDVKTNTEARAVRAKLDEKSCKEKIEGG
NT seq 351 nt   +upstreamnt  +downstreamnt
atgattgacaataaaaggttttgtttatatgatgataaaaagatgaaatcagaatggaag
gagggtttgctatgccaaggaatttacgtgtttatcaaacagtttcatattggcgcggca
aaccttttgttctgttttcgtgaacggttttttaggtcagaccgcgcgctgaaaagcgct
gtgcgtaacatatcggttaaaaaaggcatggagctgacgcttcatgccttttttatatac
aaaatctatggaaagacaggtgtatgggatgtgaagacaaatacagaggcgagggctgtt
cgtgccaaattggatgaaaaaagctgcaaggaaaaaatagaaggcggctga

DBGET integrated database retrieval system