KEGG   Bacillus subtilis XF-1: C663_1147Help
Entry
C663_1147         CDS       T02459                                 

Gene name
argJ
Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00220  Arginine biosynthesis
bsx01100  Metabolic pathways
bsx01110  Biosynthesis of secondary metabolites
bsx01130  Biosynthesis of antibiotics
bsx01210  2-Oxocarboxylic acid metabolism
bsx01230  Biosynthesis of amino acids
Module
bsx_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    C663_1147 (argJ)
Enzymes [BR:bsx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     C663_1147 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     C663_1147 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AGE62974
UniProt: M4KX61
LinkDB All DBs
Position
1200058..1201278
Genome map
AA seq 406 aa AA seqDB search
MIQLSEDQIVKVTGDVSSPKGFQAKGVHCGLRYSKKDLGVIISETPAVSAAVYTQSHFQA
APIKVTQDSLKHGPTLKAVIVNSAIANACTGEQGLKDAYTMRESFASQLGIEPELVAVSS
TGVIGEHLDMEKIHAGIELLKETPAGSGDFEEAILTTDTVIKQTCYELAIGGKTVTIGGA
AKGSGMIHPNMATMLGFVTTDAAIEEKALQKALREITDVSFNQITVDGETSTNDMVLVMA
NGCAENECLTEDHPDWPVFKKALLLTCEDLAKEIARDGEGATKLIEAQVQGAKNNLDANV
IAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTAEEVEVYLGGQCLFKNNEPQPFS
ESLAKEYLEGNEITIVIKMDEGDGNGRAWGCDLTYDYIKINASYRT
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcagttaagtgaagatcaaattgtaaaagtaacaggtgatgtatcctcgccaaaa
gggtttcaggcaaagggtgtgcattgcgggctgcgttactcgaaaaaagacctcggcgtc
attatcagcgagacaccggccgtgagtgcagcggtttatacccaaagccactttcaggct
gctccgatcaaagtgacacaagacagcttaaagcacggaccgacactgaaagccgtcatc
gtcaacagtgccattgccaatgcctgcacgggagaacaaggcctaaaggatgcatacaca
atgcgggagagctttgcttcacagcttggcattgagccggagcttgtcgctgtttcatca
acgggtgtcatcggcgagcacttagacatggaaaaaatccatgcggggatcgagctgctg
aaagaaacacctgcgggatcaggcgattttgaggaagcgattttaacaactgatacggtg
atcaagcagacgtgctatgaactggcaatcggcggcaaaacagtcacgatcggcggagcg
gccaaaggctcagggatgatacacccgaacatggccacgatgctgggatttgtgacaact
gacgcggcaatcgaagaaaaagcgctgcaaaaggcgcttcgggaaatcactgacgtttca
tttaaccaaatcacagttgacggagaaacatccacgaacgacatggtattagttatggcg
aatggctgcgccgaaaacgagtgcctgacagaagaccatccagactggccggtctttaaa
aaagcgctcttgctcacttgtgaggatctggctaaagagattgccagagacggagaaggc
gcgacaaaactaattgaagcccaagtacagggagcgaaaaataatcttgatgcaaacgtc
attgccaaaaagattgttggctcaaatcttgtaaaaacggcagtatacggaacagatgcc
aactgggggcggatcatcggagccatcggacactccgcagcacaggtgacggcagaagaa
gtagaggtttatcttggcggccaatgcctgtttaagaataacgaacctcagccattctct
gaatctctcgccaaggaataccttgaaggaaatgaaatcaccattgtcatcaagatggat
gagggggacggaaacgggagagcgtggggctgtgacctgacctatgactatatcaaaatt
aacgcgagctatcgcacgtaa

DBGET integrated database retrieval system