KEGG   Bacillus subtilis XF-1: C663_1621Help
Entry
C663_1621         CDS       T02459                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsx01001]
    C663_1621 (prkC)
Enzymes [BR:bsx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C663_1621 (prkC)
Protein kinases [BR:bsx01001]
 Serine/threonine kinases: Other
  Bacterial family
   C663_1621 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase RIO1 Seadorna_VP7 Pkinase_fungal CwsA
Motif
Other DBs
NCBI-ProteinID: AGE63423
UniProt: M4KRM8
LinkDB All DBs
Position
1650383..1652329
Genome map
AA seq 648 aa AA seqDB search
MLIGKRISGRYQILRVIGGGGMANVYLAEDIILDREVAIKILRFDYANDNEFIRRFRREA
QSASSLDHPNIVSIYDLGDEDDIYYIVMEYVEGMTLKEYITANGPLHPKEALNIMEQIVS
AIAHAHQNQIVHRDIKPHNILIDHMGNIKVTDFGIATALSSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGRIPFDGESAVSIALKHLQAETPSTKRWNPSVPQS
VENIILKATAKDPFHRYETAEDMEADIKTAFDADRLNEKRFTIQEDEEMTKAIPIIKDEE
LAKAAGEKEAEVTNAQENKTKKNGKRKKWPWVLLTICLVFITAGILAVTVFPSLFMPKDV
KIPDVSGMEYEKAAGLLEKEGLQVDSEVLEISDEKIEEGLMVKTDPKADTTVKEGATVTL
YKSTGKAKTEIGDVTGQTVDQAKKALKDQGFKHVTVNEVNDEKNAGTVIDQNPSAGTELV
PSEDQVKLTVSIGPEDITLRDLKTYSKEAASGYLEDNGLKLVEKEAYSDDVPEGQVVKQK
PAAGTAVKPGNEVEVTFSLGPEKKPAKTVKEKVKIPYEPENEGDELQVQIAVDDADHSIS
DTYEEFKIKEPTERTIELKIEPGQKGYYQVMVNNKVVSYKTIEYPKDE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcggcaagcggatcagcgggcgttaccagattctccgcgttataggcggcggg
ggaatggccaacgtgtatttagctgaggatatcattctagaccgtgaagtcgcaattaaa
atcctgcggtttgactatgcaaatgacaatgaatttatcagacgtttccgcagagaagcc
caatccgcatcaagcctcgatcacccgaatattgtcagcatttacgatttgggcgatgaa
gatgatatttattatattgtcatggaatacgttgaaggcatgacgcttaaagaatacata
acagcaaatgggccgcttcaccctaaagaagcgctgaacatcatggagcaaattgtctca
gccatcgctcatgcccatcaaaaccagattgttcacagagacatcaagccgcataacatt
ttgattgatcatatgggaaatatcaaagtaacggattttggaattgcgacggcactaagt
tcgaccacaatcacccataccaattcagttctgggctcggtccattacttatcacctgaa
caggcccggggcggcttagccacaaaaaaatcggatatttatgcgcttggaatcgttcta
tttgagcttttaaccggccgtattccgtttgatggagagtcagcagtcagcatcgccttg
aagcatcttcaagcggaaactccttcgacaaaaaggtggaatccatcggtcccccaaagc
gttgaaaacatcatactcaaggcaactgccaaagatccttttcatcgctacgaaacggct
gaagacatggaagcagacataaaaacagcttttgatgccgacagactcaatgaaaagaga
tttacgattcaagaagatgaagaaatgacaaaagcgatacctatcattaaagatgaagaa
ctcgctaaagctgctggcgaaaaagaagctgaagtgacaaacgcacaagaaaacaaaaca
aagaagaacggcaaaagaaaaaagtggccgtgggttttgctcacgatatgcctcgttttt
atcacagctggaattcttgcggtcactgtttttccatcgcttttcatgcctaaggatgtc
aaaatacctgatgtctccggaatggaatacgaaaaagccgcagggctcttggaaaaagaa
ggtttacaggttgattccgaggtgttggaaatctcagatgaaaaaattgaagagggcctg
atggtaaaaacggaccctaaagcggataccacagtcaaagaaggcgccacggtcaccctt
tataagagcaccggaaaagcaaaaacggagatcggtgatgtgacaggccaaacggtcgac
caggcaaaaaaagcgttgaaggaccaagggtttaaacatgtaacggtaaatgaagtgaat
gacgagaaaaatgcgggcactgtcattgaccaaaacccttcagcagggactgagcttgtc
ccgagtgaagatcaagtcaaacttacagtcagtatcggacccgaagacattacgcttaga
gacttgaaaacctacagtaaagaagcagcgtctggatatctggaagacaacggattgaag
cttgtagaaaaagaagcatactcagatgatgttccagaaggacaggttgtcaaacaaaaa
ccagcagcaggtacggcagtaaagccgggaaacgaagttgaagtgacattctctctcgga
ccagagaaaaaacctgcgaaaacagtgaaagaaaaggtcaagatcccctacgaaccagaa
aatgaaggggacgagcttcaagtgcaaatcgcggttgacgatgcggatcacagcatctct
gacacttacgaagaatttaagataaaagagccgactgaacgaacgatcgaactaaagatt
gaacccggccaaaaagggtactatcaagtaatggtaaacaataaagttgtcagctacaaa
accattgagtatccgaaagatgaataa

DBGET integrated database retrieval system