KEGG   Bacillus subtilis XF-1: C663_1625Help
Entry
C663_1625         CDS       T02459                                 

Gene name
spoVM
Definition
(GenBank) factor required for normal spore cortex and coat synthesis (stage V sporulation)
  KO
K06414  stage V sporulation protein M
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    C663_1625 (spoVM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoV
Motif
Other DBs
NCBI-ProteinID: AGE63427
UniProt: M4KRA6
LinkDB All DBs
Structure
PDB: 

Position
1654646..1654768
Genome map
AA seq 40 aa AA seqDB search
MNKAVTGRYRRGQKMKFYTIKLPKFLGGIVRAMLGSFRKD
NT seq 123 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggcggttacgggacgttataggaggggacaaaaaatgaaattttacaccatt
aaattgccgaagtttttaggaggaattgtccgggcgatgctgggctcatttagaaaagat
taa

DBGET integrated database retrieval system