KEGG   Bacillus subtilis XF-1: C663_1637Help
Entry
C663_1637         CDS       T02459                                 

Gene name
rnc
Definition
(GenBank) ribonuclease III
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsx03019]
    C663_1637 (rnc)
   03009 Ribosome biogenesis [BR:bsx03009]
    C663_1637 (rnc)
   03036 Chromosome and associated proteins [BR:bsx03036]
    C663_1637 (rnc)
Enzymes [BR:bsx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     C663_1637 (rnc)
Messenger RNA biogenesis [BR:bsx03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     C663_1637 (rnc)
Ribosome biogenesis [BR:bsx03009]
 Eukaryotic type
  90S particles
   RNase
    C663_1637 (rnc)
 Prokaryotic type
  rRNA processing factors
   C663_1637 (rnc)
Chromosome and associated proteins [BR:bsx03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     C663_1637 (rnc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm Phage_P2_GpU DND1_DSRM
Motif
Other DBs
NCBI-ProteinID: AGE63439
UniProt: M4KY90
LinkDB All DBs
Position
1664951..1665700
Genome map
AA seq 249 aa AA seqDB search
MSKHSHYKDKKKFYKKVEQFKEFQERISVHFQNEKLLYQAFTHSSYVNEHRKKPYEDNER
LEFLGDAVLELTISRFLFAKYPAMSEGDLTKLRAAIVCEPSLVSLAHELSFGDLVLLGKG
EEMTGGRKRPALLADVFEAFIGALYLDQGLEPVESFLKVYVFPKINDGAFSHVMDFKSQL
QEYVQRDGKGSLEYKISNEKGPAHNREFEAIVSLKGEPLGVGNGRSKKEAEQHAAQEALA
KLQKHHTKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacactcacattataaagataaaaaaaagttctataaaaaagtagaacaattt
aaagagtttcaagaacggatttcggttcactttcaaaatgaaaagcttttgtatcaagca
tttacacattcatcttatgtgaatgagcatcggaaaaagccgtatgaagataatgaaagg
cttgaatttttaggtgacgctgttttggaactgacgatctccagattcttatttgccaaa
tacccggctatgagtgaaggagatttgacgaaattgagagccgcaattgtttgcgaaccg
tctctcgtttcattggctcacgagctgtcattcggcgatcttgtcctgttgggtaaaggc
gaggaaatgacaggcggaagaaagcgtcctgctctattggcggatgtttttgaggcattt
atcggagccttgtatcttgaccagggattagagccggtcgaaagtttcttaaaagtttat
gtgttccctaaaattaacgatggtgctttttctcatgtgatggatttcaaaagccagctg
caggaatacgtgcagcgggacggcaaaggctctctggagtataaaatctccaacgaaaaa
ggacctgcgcacaaccgtgaatttgaagccatcgtatctctaaaaggtgaaccactcgga
gtcggaaacggccgttcaaagaaagaagccgaacagcacgctgctcaggaagctttagct
aaattgcaaaaacaccatacgaaacaataa

DBGET integrated database retrieval system