KEGG   Bacillus subtilis XF-1: C663_1651Help
Entry
C663_1651         CDS       T02459                                 

Gene name
ylqG
Definition
(GenBank) putative glycosyltransferase
Organism
bsx  Bacillus subtilis XF-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFP2b TTRAP
Motif
Other DBs
NCBI-ProteinID: AGE63453
UniProt: M4KRT2
LinkDB All DBs
Position
1677491..1679221
Genome map
AA seq 576 aa AA seqDB search
MNIRNDVQKALQHLFGRTAVPQETSKVNEALNGEKRLLLGKVLRLLGDQHALIQVGNQTV
QGKLETQLRPQAYYWFSYEKKTAEQTGRLQVVQSFDQNPKTIQDAAGKLLNAISVKTSNA
ALMMTGAMLKSKTPVTENDIKTAVRWMDTLPSQDTKKAVETVLFALKRDLPIHSEILNGV
HAVKSPVPLHQHVSQLLRAIDQNPQQSQMISKLKEAVTVLLNSEIDVHAERLIDKLISLT
DNTKAPSPANTAGSRELSTPAGSPGKASLPIANHTAEQRSIQEEPVKTAADIPIKEARQL
LVKLTESAEKNSLQIVKEAANWIKAAASSGDSKSLAASAVLQAAQVTDQEAEVFLKAVQQ
TAPHLADKADVLSFLSKVKTAIGARDEVAFIKAFEQGSAVTSGEMQSIKLALSALRASHE
VAEPVKQEADQLFHKLNGQLFMQQDHPSYSQIVMSFPMFSKSGVQDMTVLFKGKKEADGK
LDPSHCRLLFLLQLDTLKETVVDCLVQQKVMTITIETDFELQAAIDPMVPALKQGLKEMG
YSLSGVNAKKRDHTEEKASIDQYITSISDQEVDVKI
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacgaaatgatgtgcaaaaggcgctgcagcaccttttcgggcgtacagccgtc
ccgcaggaaacatcaaaagtaaacgaagcgctaaacggggagaagcgtctcctcttagga
aaagtgcttcgtttactaggagatcagcatgccctgatccaagtcggcaatcaaactgtt
cagggaaaacttgaaacccagcttcgtcctcaggcatactattggttttcctacgaaaaa
aaaacggcagaacaaacaggccgtcttcaggtcgttcaaagctttgatcaaaatcctaaa
accattcaggatgcagctggcaaacttttaaatgccatttcagtgaagacgtcaaacgca
gctctcatgatgacaggagcgatgctgaaaagcaaaacacccgtaacagaaaatgatatc
aaaacagctgtccgctggatggacacgctgccttcgcaagacacaaaaaaagcagttgaa
acggttctcttcgctttaaagcgtgatcttcccattcactccgagattttgaatggtgtt
catgctgtgaaatcgcctgttccgttgcatcagcacgtatcccagctgcttcgggcaatc
gaccaaaaccctcagcagagccaaatgatatcaaagctaaaggaagcagttacggtgctt
ttaaatagtgaaatcgatgtccatgcagaacggctgattgataagcttatttctttaacc
gacaatacgaaagcaccttctccggcgaatacagctggaagcagggagcttagcacacca
gctggctcccccggaaaagccagcctgccgattgcaaatcacacagcagaacagagaagc
atacaagaagagcctgttaaaacagcagcagacattccaattaaagaagcccgccagctg
ctggtgaagctgacggaatctgctgaaaaaaacagtctccaaattgtgaaagaggcagca
aattggattaaagcggctgcttcatcgggtgatagtaagtcacttgcagcttcagctgtt
ttacaggcggcacaagtcacagaccaggaagccgaagtctttttaaaggctgttcagcag
acagcaccccatttggcggataaggcagatgttctttctttcttatccaaagtgaaaacg
gcaatcggcgcaagggacgaggttgcgttcattaaagcgtttgaacaaggaagcgcagtc
acatctggcgaaatgcaatccatcaagctggctctttctgctttaagagcatcgcatgag
gtagccgaaccagtcaaacaagaagccgatcagctttttcataaattaaatggccagctt
ttcatgcagcaggaccatccgtcatacagccaaattgtaatgtcatttccgatgttttcg
aagtcaggggttcaggacatgactgttctgtttaaaggaaagaaggaagcagatggaaag
cttgatccttcccattgccgccttttgtttttgctgcagcttgatacactaaaagaaacc
gtcgttgattgcttggtacagcaaaaagtcatgacgattacaatagagactgatttcgag
ctgcaggctgcgatcgatccgatggtgcccgcgcttaaacaggggctaaaggaaatgggg
tacagcctttcaggggtaaacgctaaaaaaagggatcacaccgaagaaaaggcttcaatc
gatcaatatataacaagtatcagtgatcaggaagtggatgtgaaaatatga

DBGET integrated database retrieval system