KEGG   Bacillus subtilis XF-1: C663_1668Help
Entry
C663_1668         CDS       T02459                                 

Gene name
fliI
Definition
(GenBank) flagellum-specific ATP synthase
  KO
K02412  flagellum-specific ATP synthase [EC:7.4.2.8]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    C663_1668 (fliI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bsx02044]
    C663_1668 (fliI)
   02035 Bacterial motility proteins [BR:bsx02035]
    C663_1668 (fliI)
Enzymes [BR:bsx01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     C663_1668 (fliI)
Secretion system [BR:bsx02044]
 Type III secretion system
  Flagellar export apparatus
   C663_1668 (fliI)
Bacterial motility proteins [BR:bsx02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    C663_1668 (fliI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ATP-synt_ab_N ABC_tran RsgA_GTPase DUF87
Motif
Other DBs
NCBI-ProteinID: AGE63469
UniProt: M4KYA4
LinkDB All DBs
Position
1695099..1696382
Genome map
AA seq 427 aa AA seqDB search
MTDSYKRYGKVKRVIGLMIESKGPASSIGDVCLIYAKGQSGKVIKAEVVGFQEENILLMP
YLEAASIAPGSIVEATGESLRVKVGAGLIGQVIDAFGEPLDGKLLPKGLSPVSTEQSPPN
PMKRPPIREKMGVGVRSIDSLLTVGKGQRIGIFAGSGVGKSTLMGMIAKQTEADLNVIAL
VGERGREVREFIEKDLGKEGLKRSIVVVATSDQPALMRLKAAYTATAIAEYFRDKGQNVM
FMMDSVTRVAMAQREIGLAAGEPPTTKGYTPSVFAILPRLLERTGANEHGTITAFYTVLV
DGDDMNEPIADTVRGILDGHIVLDRALANKGQFPAVNVLKSISRVMSNISTKQHMDAANK
FRELLSTYQNSEDLINIGAYKRGSSREIDEAIQFYPQLIQFLKQETDESALLEESIAALT
SLTGNEE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcgtataaacggtacggaaaagtcaagcgggtaatcggcctgatgattgaa
tcaaaagggcctgcaagctcaattggcgacgtgtgcctgatttatgcaaaaggacaatct
gggaaagtcattaaagctgaggtagtcggcttccaggaagaaaatattttgcttatgcct
tatttagaggctgcgagcattgcacctggcagcattgtagaagctactggggaatcactt
cgggttaaagttggagccggactgatcggacaagtcatcgatgcttttggagaaccgctt
gacggaaaacttctgccgaaagggctttcgcctgtatcgactgagcaatcaccgcccaac
ccgatgaaacggccgcctatccgtgaaaagatgggtgttggagtcagatcaattgacagc
ttgctgacagtcggtaaaggccagcggattggaatttttgcaggaagcggtgtcggaaaa
agcaccttaatggggatgatcgccaagcagacagaggctgacttaaacgtcattgcactt
gtcggagaacgcggacgagaggttcgggagtttattgaaaaagatcttgggaaagagggg
ctgaaacgatcgattgtagtcgttgccacctcagaccagccagcattaatgagattgaaa
gcggcatatacagcgactgcaattgccgagtatttccgagataaaggccaaaatgtcatg
tttatgatggattctgttacaagggtggcaatggcgcagcgagagattggactggctgcc
ggagagcctccgacgacaaaaggctatacaccttcagtgttcgctattttacctcgttta
ctagaacgaacaggtgcaaacgagcatggaaccattacggcattttatacagtgttggta
gacggggatgatatgaatgagccgattgccgatactgtacgcggaattttagacggacat
attgtgttggacagggcgcttgccaataaaggccagtttcctgcagttaacgtactaaaa
agcatcagcagggtgatgtcaaacatatcaacaaaacagcacatggatgcggcaaataaa
ttccgtgaacttttatcaacatatcaaaattcggaagatctcattaatatcggagcttat
aaaagaggatcctcaagagaaattgatgaagcgatacaattttatccgcagcttattcaa
tttttaaagcaggaaacagacgaatcggctttattggaagaaagcattgctgcattaact
agtttgacaggaaatgaggaataa

DBGET integrated database retrieval system