KEGG   Bacillus subtilis XF-1: C663_1672Help
Entry
C663_1672         CDS       T02459                                 

Gene name
fliK
Definition
(GenBank) flagellar hook-length control protein
  KO
K02414  flagellar hook-length control protein FliK
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    C663_1672 (fliK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsx02035]
    C663_1672 (fliK)
Bacterial motility proteins [BR:bsx02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    C663_1672 (fliK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_hook CsbD
Motif
Other DBs
NCBI-ProteinID: AGE63472
UniProt: M4KRE7
LinkDB All DBs
Position
1697467..1698930
Genome map
AA seq 487 aa AA seqDB search
MKLLELAGPLLQTTTGSAAKNMKSSQGVFQNWLMSEAGLKELSEQGKGTPNSEDQLLADA
LKKIGEWLNANPEDQDKQNADLLQTLSKLTGKQLDANALQMLQNLLQAVESKMSGGTDQL
LTETEKIFSEAKTALSANDSATDINGALKSDTEQSNQENEVSEPAKELIYIQMFISQLVE
GNKLTDRGNGNEAHAIYQNGDQFLSALEKKGVSQQLIQDLKQQIFTKAESSSKLYSMTAS
ELKSFQSLMDQMSMLPQKGTKEWSLAESQLKAFLLSKSSESSQDFGKRVLTPLSQSSSSK
NASDVSGSIQPVDSKSGLQMLFSGYRGIGGVQTLDLQQMSSDIPNAETKTVADQVINAWK
QMKYTPFGRSTGSFTIRLNPEHLGFVTIKLTNENGMFQSKIIASSQSAKELLEQHLPQLK
QSLPNMAVQIDRFTLPVQSGDQPVYGQLADEQKQQQEGQRQQRQKKQSNDFGDLLDEVSM
VEMEEEE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgcttgaattagccggacctttgctgcaaaccacaacgggttctgccgctaaa
aacatgaaaagtagccagggagtttttcaaaactggcttatgtctgaggctggattgaag
gaactttcagaacaaggaaagggtactcctaattccgaagatcagcttttagcagatgcg
cttaaaaagatcggtgaatggctaaatgcaaatcctgaagaccaagacaaacaaaatgcg
gatcttttgcaaacattaagcaaactgacagggaagcaattggatgcgaatgctctgcaa
atgttgcaaaatcttttgcaagcagttgaatcaaaaatgtcaggcgggacggatcaattg
ctcacagaaacggagaaaatcttttcagaagctaaaacggctctgagtgccaatgattct
gctactgacattaatggagcactgaagtctgatacagagcaatcaaatcaggaaaatgaa
gtatccgagcctgctaaagagcttatctatatccagatgttcattagccagctcgtagaa
gggaataagctgactgatcgcgggaatggcaatgaagctcatgccatttaccaaaatgga
gatcaattcctttctgcattagaaaagaagggtgtatctcaacaactaattcaggatctt
aaacagcaaatattcactaaagctgagtcaagttcaaaactttactccatgacagcgtca
gagctgaaaagttttcaaagcttaatggatcaaatgtctatgcttcctcaaaaagggact
aaagaatggagtttagctgaaagccagctgaaagccttcttgttatcgaaatcatccgaa
tcatcacaagactttgggaagcgtgttctcacaccgctctcgcagagttcatccagcaaa
aatgcatcggatgtttctggaagtattcagcctgtagatagtaaatcaggactccaaatg
ctgttttcggggtatcggggcataggaggagttcaaacacttgatctacagcagatgtca
tctgatataccaaatgccgaaacaaaaacggtggctgatcaagtgattaatgcgtggaag
cagatgaaatatacgcctttcggcagatcgacgggaagcttcactattcggctgaaccct
gaacatttaggatttgtcacaatcaagctgacaaatgaaaatggaatgtttcagagtaaa
atcattgcatctagtcaatcagcaaaagaattgcttgaacagcaccttcctcagctgaag
caatcattgccgaatatggccgtccaaattgaccgttttactcttccagtccaaagcggg
gatcagccggtatacggccagcttgctgatgaacagaaacagcagcaagaggggcagaga
cagcaaaggcagaaaaagcaatcaaatgattttggcgatctgctcgatgaagtgtcgatg
gttgaaatggaggaagaagaatga

DBGET integrated database retrieval system