KEGG   Bacillus subtilis XF-1: C663_1699Help
Entry
C663_1699         CDS       T02459                                 

Gene name
uppS
Definition
(GenBank) undecaprenyl pyrophosphate synthase
  KO
K00806  undecaprenyl diphosphate synthase [EC:2.5.1.31]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00550  Peptidoglycan biosynthesis
bsx00900  Terpenoid backbone biosynthesis
bsx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C663_1699 (uppS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C663_1699 (uppS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsx01006]
    C663_1699 (uppS)
Enzymes [BR:bsx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.31  ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]
     C663_1699 (uppS)
Prenyltransferases [BR:bsx01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   C663_1699 (uppS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prenyltransf
Motif
Other DBs
NCBI-ProteinID: AGE63498
UniProt: M4KRX5
LinkDB All DBs
Position
1720403..1721185
Genome map
AA seq 260 aa AA seqDB search
MLNILKNWKNQQTAASNLERYTKEDILKGEIPEHIAIIMDGNGRWAKKRSLPRIAGHHEG
MKVVKRTTKLANELGVKVLTLYAFSTENWKRPKMEVDFLMKLPEEFLNTYLPELVEENVQ
VRIIGDETALPAHTLRAIEKAVQDTAQNDGMILNFALNYGGRTEIVSAAKSLAEKVKEGS
LNIEDIDESLFSTYLMTESLQDPELLIRTSGEIRLSNFMLWQVAYSEFVFTDVLWPDFKE
DHFLQALGEYQQRGRRFGGI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacatactcaaaaattggaagaatcagcaaactgcggcttccaacttagaacgt
tatacaaaagaagacatacttaagggagaaattcccgaacacatcgccattatcatggat
ggaaatggccgttgggctaaaaaacgctctcttcccagaattgcaggccaccatgaaggg
atgaaggtggtaaaaaggaccacaaagctcgcaaacgaattaggtgtcaaagtactgaca
ttgtatgcattttcaacagaaaactggaaaagaccgaaaatggaagtcgattttttaatg
aagcttccggaagaatttttgaatacgtatcttccagagcttgttgaggaaaatgtacag
gttcggatcattggggatgaaacggctttgccggcgcacacattacgtgcaattgaaaaa
gctgtacaggacacggcgcaaaacgacggaatgatccttaattttgctcttaactatgga
ggccgtactgaaattgtcagtgctgcaaaatcactcgcggaaaaagtgaaggaaggctct
ttgaatattgaagacattgatgaatcgcttttttctacttatttgatgactgaatctttg
caggatcctgaacttttaattcgaacgagcggcgagataaggctgagtaattttatgcta
tggcaggttgcctacagtgaatttgtctttactgacgtcttgtggcctgactttaaagaa
gatcacttcttgcaggcgttaggagagtatcagcagagaggccggaggtttggcggaatt
tag

DBGET integrated database retrieval system