KEGG   Bacillus subtilis XF-1: C663_1712Help
Entry
C663_1712         CDS       T02459                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine 55 synthase
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsx03016]
    C663_1712 (truB)
Enzymes [BR:bsx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     C663_1712 (truB)
Transfer RNA biogenesis [BR:bsx03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    C663_1712 (truB)
 Prokaryotic type
    C663_1712 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 PseudoU_synth_2 TruB_C
Motif
Other DBs
NCBI-ProteinID: AGE63511
UniProt: M4KVB1
LinkDB All DBs
Position
1736069..1736998
Genome map
AA seq 309 aa AA seqDB search
MVNGVLLLHKPVGMTSHDCVMKIRKLLKTKKVGHTGTLDPEVSGVLPICVGRATKIVEYL
TEKSKTYDAEITLGFSTTTEDQTGETVETKPVNHDIDKADVEKVLNSLKGKQEQIPPMYS
AVKVNGKKLYEYARAGIEVERPKRMITIEDIALTTEIKHHGETASFRFTVTCSKGTYVRT
LAVMIGEKLGYPAHMSHLIRTASGDFSLDECFTFDELEAQAQSGTVEEHTVPIERALNHL
PKWIISDTLAKKVENGALLETPEQFSEMTSEDRIAVFTESGTCLAIYFPHPAKKGLLKPA
KVLMQKSEQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggttaacggagttctccttttacataaacctgttggcatgacatcgcacgactgtgtc
atgaagatccgaaagctgttaaaaacaaaaaaagtaggacatacaggaacgctcgatccg
gaagtgtcaggcgtgcttccgatttgtgtaggaagagcgacaaaaatagtcgaatactta
actgaaaaatctaaaacgtatgatgcagaaataacgcttggcttttcaaccacaacagag
gatcaaaccggagaaacggtggaaacaaagcctgtcaatcacgacattgataaagcggat
gtagaaaaggttttaaacagtttaaaggggaaacaagaacaaattccgcccatgtattcc
gctgtaaaagtaaacggcaaaaaattatacgaatacgcaagagcagggattgaagtagaa
cgtccgaaacgtatgataaccattgaagacattgccctgacgacagagattaaacatcat
ggagaaactgcaagcttccggtttacagtgacttgctccaaagggacctatgtaaggacg
ctggcggtcatgatcggagaaaagctcggatatccggctcatatgtctcatttaatccgt
acggcatccggagatttttctctcgacgaatgctttacttttgatgagctcgaagcacag
gcccaatccggaaccgtggaagagcatacagttcctattgaacgtgcgctcaatcatttg
ccgaaatggatcataagtgatacattagctaagaaagtagaaaatggggctttgcttgag
acgcccgagcagttttctgaaatgacaagtgaagaccgtattgccgtctttactgaatcc
ggaacctgcttggcgatctatttccctcatcctgcaaaaaaagggctgttaaagccggca
aaagtattgatgcaaaaaagcgaacaatag

DBGET integrated database retrieval system