KEGG   Bacillus subtilis XF-1: C663_1756Help
Entry
C663_1756         CDS       T02459                                 

Gene name
acpK
Definition
(GenBank) acyl carrier protein
  KO
K15337  polyketide biosynthesis acyl carrier protein
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsx01008]
    C663_1756 (acpK)
Polyketide biosynthesis proteins [BR:bsx01008]
 Polyketide tailoring proteins
  beta-Branched incorporating proteins
   C663_1756 (acpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: AGE63553
UniProt: M4KS25
LinkDB All DBs
Position
1787741..1787941
Genome map
AA seq 66 aa AA seqDB search
MLPELDGHRFEPEDQLVELGADSVDRAEIITMVLEDLSLKIPRIELSGVKNIGELAEVLY
DKVQSA
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcctgaattagacggacacagatttgagcctgaagatcagttagttgagttagga
gctgactctgtagacagagctgaaattatcacgatggtgctagaggatttatcgttaaaa
atccctcgcattgagctatccggggtgaaaaacatcggtgaattagctgaggtgctttat
gacaaagtgcaatctgcctga

DBGET integrated database retrieval system