KEGG   Bacillus subtilis XF-1: C663_2097Help
Entry
C663_2097         CDS       T02459                                 

Definition
(GenBank) hypothetical protein
Organism
bsx  Bacillus subtilis XF-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NuA4 LicD PIH1_CS HSP20
Motif
Other DBs
NCBI-ProteinID: AGE63873
UniProt: M4KSW7
LinkDB All DBs
Position
2191770..2192198
Genome map
AA seq 142 aa AA seqDB search
MAKLEFHDDKKNELQKKEEIITEAIDTLFQSSAFGNLINGFQNLINSSLKDVQTTIHVRE
KDTGLYIDITIPATFRDGEIVVDVKSRYLHVTLQEKQKHQNEATFTSMTRTVQLPYEVRQ
EDMETSWNEQTMTLFFPKNKHE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaattggaattccatgatgacaaaaagaacgaactgcaaaagaaagaagaaatc
ataacggaggcaatcgacactctttttcaatcctcagcgttcggcaaccttataaacgga
tttcagaacctgatcaactcgagtttaaaggatgtgcagacgaccatacatgtcagagaa
aaagatactggtctgtatatcgatattaccattccggcgacgtttcgagatggcgagatc
gtcgttgatgttaaatcgaggtatctccatgtaaccctccaagaaaaacagaaacaccaa
aatgaggctacctttacaagcatgacaagaacggttcagctgccttatgaagttcgccaa
gaagatatggaaacgtcttggaacgagcagacaatgacacttttctttccaaaaaataag
catgaatga

DBGET integrated database retrieval system