KEGG   Bacillus subtilis XF-1: C663_2538
Entry
C663_2538         CDS       T02459                                 

Gene name
levG
Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IID component
  KO
K02771  fructose PTS system EIID component
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00051  Fructose and mannose metabolism
bsx02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C663_2538 (levG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    C663_2538 (levG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsx02000]
    C663_2538 (levG)
Transporters [BR:bsx02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    C663_2538 (levG)
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AGE64295
UniProt: M4KVE4
LinkDB
Position
complement(2571635..2572462)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagaaagaaaaacgattaacgaaaaaagaaattttcagcatgtttattcgttcaaat
tttttactcggttcctttaacttcgaacgtgtgcaggcaatgggatattgttatgtcatg
ataccggcgatcaaaaaattgtacggtcccggagcgaaaagaaacgaagccttgcagcgg
catttggaatggtttaatacacatccgtggctgacagcgcctatatttggcgtgacggca
gccatggaagaagaaatggcgaacaataaaggaattgacggaaaagcgataagcggaatg
aaaatcggtttgatgggaccaatagcgggcgtaggcgacccgattttctggggaacgatt
cgtcctgtcttagctgcgctaggagcctcccttgctttaggaggaaacattgccggtcct
ttgctattctttttcttgctgaatgccataagattaagcacaaaatattacggattaaag
tatggctatgtgaaaggaatggagattcttcaggatttagcggggaatcgcattcaaaag
cttacagagggcgcttcgattctcggattatttgttatgggggctctcgtgtccaaatgg
accaccatcaacattccaatcgttgtatccaggattaaggatgaaagcggaaaagtagat
gttcaaactgtacaaaacgtgttagacagcattatgccgggtgcgctgcctctcggatta
acgttattggtggcatggatgcttcgcaaaggggtgaatcctcttctcattatttgcggc
atctttgtcatcgggattctcgggtattgggctggattcttagcataa

DBGET integrated database retrieval system