KEGG   Bacillus subtilis XF-1: C663_2764Help
Entry
C663_2764         CDS       T02459                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00010  Glycolysis / Gluconeogenesis
bsx00030  Pentose phosphate pathway
bsx00051  Fructose and mannose metabolism
bsx00052  Galactose metabolism
bsx00680  Methane metabolism
bsx01100  Metabolic pathways
bsx01110  Biosynthesis of secondary metabolites
bsx01120  Microbial metabolism in diverse environments
bsx01130  Biosynthesis of antibiotics
bsx01200  Carbon metabolism
bsx01230  Biosynthesis of amino acids
bsx03018  RNA degradation
Module
bsx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsx_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C663_2764 (pfkA)
   00030 Pentose phosphate pathway
    C663_2764 (pfkA)
   00051 Fructose and mannose metabolism
    C663_2764 (pfkA)
   00052 Galactose metabolism
    C663_2764 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    C663_2764 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    C663_2764 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bsx01009]
    C663_2764 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bsx03019]
    C663_2764 (pfkA)
Enzymes [BR:bsx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     C663_2764 (pfkA)
Protein phosphatases and associated proteins [BR:bsx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     C663_2764 (pfkA)
Messenger RNA biogenesis [BR:bsx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     C663_2764 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AGE64516
UniProt: M4KY30
LinkDB All DBs
Structure
PDB: 

Position
complement(2798380..2799339)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggggtattaacgagcggcggggattccccgggaatgaacgcagcagtt
cgcgcagtagtcagaaaggcgatctatcatgacgttgaagtttacggtatttacaacgga
tacgcgggattgatcagcggaaagattgaaaagcttgaactcggatcagtaggcgatatt
atacatcgtggaggaactaagctttatacggcaaggtgtcctgaattcaaaacagttgaa
ggccgtgaaaaagggatagaaaacttgaagaagcttggtattgaaggccttgttgttatc
ggcggagacggttcatatatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacaatcgataatgacattccgggcactgattttacaatcggtttcgat
acagctttaaatacagtaattgacgcaattgataagattcgcgatacagcgacttctcat
gaacgtacatatgtaatcgaagtaatgggccgtcatgccggcgatattgcattgtgggcc
ggtcttgcagggggcgcggaatcgatcttaatccctgaggcagactatgacatgcacgaa
atcattgctcgcttaaaacgcggccacgaacgcggcaagaaacacagtattattattgtt
gccgaaggtgtaggcagcggtgttgaattcgggaaacgcatcgaagaagaaacaaacctt
gaaactagggtatctgtattgggccatatccagcgcggaggttctccgagtgctgctgac
cgtgtgttagcaagccgtctcggcgcatatgcagttgaactgctgcttgaaggaaaaggc
ggacgctgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatactg
gagacaaaacacacagttgagcaaaacatgtatcagctttcaaaagaactgtctatctaa

DBGET integrated database retrieval system