KEGG   Bacillus subtilis XF-1: C663_3494Help
Entry
C663_3494         CDS       T02459                                 

Gene name
ywrO
Definition
(GenBank) nitroreductase
Organism
bsx  Bacillus subtilis XF-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_2 FMN_red
Motif
Other DBs
NCBI-ProteinID: AGE65206
UniProt: M4KZ45
LinkDB All DBs
Position
complement(3536506..3537033)
Genome map
AA seq 175 aa AA seqDB search
MKILVLAVHPHMETSVVNKAWADELSKHDNITVRDLYKEYPDEEIDVAKEQQLCEEYDRI
VFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGAN
HYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISLSAKRLAEYIQQPFV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattggttttggcagtgcatcctcatatggagacctcagttgttaataaggcg
tgggctgatgaattgagtaaacatgacaatatcacagtacgggatctttataaggaatac
ccggatgaagaaatagatgttgcgaaggaacagcagctgtgcgaggaatacgatcggatt
gtctttcaattcccgctatattggtacagctctccgccgctcttgaaaaaatggcaggat
cttgtgctgacttacggctgggcttttggttcagaaggaaatgccttgcatggcaaggag
ctgatgctggctgtatcaacagggagcgaagcggaaaaatatcaagcgggcggagcaaat
cattactcgatcagtgagctattgaaaccatttcaggctacaagtaatctgatcggcatg
aagtatctgcctccatatgtgttctatggcgtgaattatgcagctgcagaggatatttct
ctcagtgcaaaacggttagccgaatacatccagcagccttttgtttaa

DBGET integrated database retrieval system