KEGG   Bacillus subtilis XF-1: C663_3674
Entry
C663_3674         CDS       T02459                                 

Gene name
ywfG
Definition
(GenBank) transaminase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx00998  Biosynthesis of various secondary metabolites - part 2
bsx01100  Metabolic pathways
bsx01110  Biosynthesis of secondary metabolites
Module
bsx_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    C663_3674 (ywfG)
Enzymes [BR:bsx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     C663_3674 (ywfG)
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AGE65382
UniProt: M4KWQ6
LinkDB
Position
complement(3711243..3712442)
AA seq 399 aa
MEITPSDVIKTLPRQEFSLVFQKVKELEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYARAAAFAKEHNIHLIHDFAYGAFEFDQKPASFLETEDAKIVGAELYSFSKT
FNMAGWRMAFAVGNEKIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKE
RIDFFTELCEKELGWKMEKPKGTFYVWAEIPNTFETSHQFSDYLLEHAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVMRIQKLNLPFGSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaggagttttctctcgtt
tttcaaaaggtaaaggaattggaaaaaacgggggcccacatcattaatctcggacagggg
aaccctgaccttcccactccgccgcatattgtggaggctttgcgggaggcttctctgaat
ccttcgtttcatggatacggccctttcaggggctatccttttttaaaggaagcgatcgct
gctttctataaaagggaatacggagtgacaatcaatcctgaaacggaggtcgcgcttttc
ggaggcgggaaagcaggcttgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctaccctgaatatttatcagggattacgatggcgcgagct
gagctttacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactatccgaacaaccccact
ggagctgtggctgatgcggctttttatgcaagagctgctgcttttgcgaaagagcataac
atccatttgattcatgattttgcatacggagcgtttgaattcgatcaaaaaccggccagc
tttcttgagacagaggatgcaaaaattgtcggagcagagctttattcattttcaaaaaca
tttaacatggccggctggagaatggcgtttgcggttgggaacgaaaagatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttctggagatccggagcatacggaatcgttgaaacgaatttataaggaa
cgaattgacttttttacggagctttgcgaaaaggaactgggctggaagatggaaaagcca
aaaggaaccttttacgtatgggctgaaattccgaatacgtttgagacatctcaccaattt
tccgattacttgctggagcatgcccatgtcgtagtcacaccgggcgaaatttttggaagc
aacggaaaaagacatgtcagaatctcaatggtgtcgaagcaggaggatctgagggaattt
gtcatgcggattcaaaagctgaacctgccgttcgggtcattacaagaaacatcccgctaa

DBGET integrated database retrieval system