KEGG   Bacillus subtilis XF-1: C663_3926Help
Entry
C663_3926         CDS       T02459                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase (large subunit)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C663_3926 (ahpF)
Enzymes [BR:bsx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C663_3926 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like AlaDh_PNT_C Thi4 DAO FAD_oxidored NAD_binding_7 FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGE65619
UniProt: M4L0J6
LinkDB All DBs
Position
3959696..3961225
Genome map
AA seq 509 aa AA seqDB search
MVLDANIKAQLNQYMQLIENDIVLKVSAGEDDTSKDMLALVDELASMSSKISVEKAELNR
TPSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRPPKVDQKVIDQVKKISGEYHF
ESYISLTCHNCPDVVQALNMMSVLNPNITHTMIDGAAYKAEVESKNIMAVPTVYLNGESF
GSGRMTLEEILAKMGSGTDASEFADKEPFDVLVVGGGPAGASAAIYTARKGIRTGVVAER
FGGQVLDTMSIENFISVKATEGPKLAASLEEHVKEYDIDVMNLQRAKRLEKKDLFELELE
NGAVLKSKTVILSTGARWRNVNVPGEQEFKNKGVAYCPHCDGPLFEGKDVAVIGGGNSGI
EAAIDLAGIVNHVTVLEFAPELKADEVLQKRLYSLPNVTVVKNAQTKEITGDQSVNGITY
VDRETGEEKHVELQGVFVQIGLVPNTEWLEGTVERNRMGEIIVDKHGATSVPGLFAAGDC
TDSAYNQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttggtacttgatgcaaacatcaaagcacaattaaatcaatatatgcagctaattgagaat
gatattgttctcaaagttagcgcaggcgaagatgacacttctaaggacatgctggctctc
gttgatgagctggcttccatgtcatcgaaaatttcagttgaaaaagctgaattaaacaga
acgccaagcttcagtgtcaatcgtgtcggagaagacactggcgtgactttcgccggtatc
cctctgggccacgaattcacatcattagtgttggcgctgctccaagtgagcggcagaccg
cctaaagtagaccaaaaagtcattgatcaggtgaagaagatcagtggtgaataccacttc
gaatcttatatcagcctgacatgccacaactgtcctgatgttgtacaggctttaaacatg
atgagcgtgctgaacccgaacattacgcacacgatgattgacggtgcagcatacaaagca
gaagttgaaagcaaaaacatcatggcagtgccgaccgtttacttgaatggcgaatccttc
ggaagcggccgtatgacgcttgaagaaattcttgcgaaaatgggcagcggcacagatgca
tctgagtttgctgacaaagagccgtttgacgttcttgttgtcggaggcggacctgctggt
gcaagtgcagcgatctacactgcacgtaaaggcatccgcactggtgttgtggctgagcgc
ttcggcggacaggtgctcgacaccatgagcatcgaaaacttcatcagcgtcaaagcgacg
gaaggaccgaagcttgcggcaagtcttgaagagcatgtgaaggaatatgatattgatgtc
atgaaccttcagcgtgcgaaacgccttgagaagaaagatctgttcgaacttgaactcgaa
aacggcgctgttctgaaaagtaaaacagtgatcctttcaacaggtgcacgctggcgcaat
gtcaacgtaccaggtgaacaagagttcaaaaacaaaggtgtcgcatactgcccgcactgt
gatgggccattgtttgaaggcaaagacgtagcggtaatcggcggcggaaactctggtatt
gaagcagcgattgaccttgcaggtattgtcaatcatgttactgtgctagagttcgcaccg
gaactgaaagcagacgaagtcctgcaaaaacgtctctacagcctgcctaacgttactgtt
gtaaaaaacgcacaaacaaaagaaatcacaggcgatcagagcgttaacggcatcacatac
gtagaccgcgaaacaggcgaagaaaaacacgttgaacttcaaggtgtattcgtccaaatc
ggtctcgtgccaaacacagaatggttagaaggaacggttgaacgcaaccgcatgggcgaa
attattgtcgacaaacacggcgcaacaagcgtaccaggcttatttgctgccggcgactgc
acagacagtgcgtacaaccaaattattatttctatgggatcaggtgcaactgccgccctc
ggcgcgtttgattacctaatccgtaactaa

DBGET integrated database retrieval system