KEGG   Bacillus subtilis XF-1: C663_3998Help
Entry
C663_3998         CDS       T02459                                 

Definition
(GenBank) hypothetical protein
Organism
bsx  Bacillus subtilis XF-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjbR
Motif
Other DBs
NCBI-ProteinID: AGE65690
UniProt: M4KYS8
LinkDB All DBs
Position
4027794..4028150
Genome map
AA seq 118 aa AA seqDB search
MLTREDIFKHVKKKYGTSPDYPWGKYPNYASLRHTSNKKWYGLIMNVLPEKLGLEGHGEI
DILNLKCPPDISDGLRNGENILPGYHMDKEHWISIVLERTDPESEIYSLIEQSFHLTK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgttgacaagagaagatatctttaaacacgtcaaaaaaaaatacggtacatcgcctgat
tatccgtgggggaaatacccaaactatgcttctttgagacatacatcaaacaaaaaatgg
tacggtcttatcatgaatgttctcccagaaaaattaggcctggaaggacatggcgaaata
gatattctgaatttaaaatgcccccctgacataagtgatggcttaagaaatggggaaaat
atcttacccggatatcatatggataaggaacattggatttcaattgttttagaacggaca
gatccagaaagcgaaatctatagcttaatcgaacagagctttcatttaaccaagtga

DBGET integrated database retrieval system