KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_00570Help
Entry
I653_00570        CDS       T02520                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bsy03012]
    I653_00570
   03029 Mitochondrial biogenesis [BR:bsy03029]
    I653_00570
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsy04147]
    I653_00570
Translation factors [BR:bsy03012]
 Eukaryotic Type
  Elongation factors
   I653_00570
 Prokaryotic Type
   I653_00570
Mitochondrial biogenesis [BR:bsy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    I653_00570
Exosome [BR:bsy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   I653_00570
  Exosomal proteins of breast cancer cells
   I653_00570
  Exosomal proteins of colorectal cancer cells
   I653_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: AGI27385
LinkDB All DBs
Position
132297..133487
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL
EGDAEWEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREEIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIHLPEGVEMVMPGDNTE
MNVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatattggtacaattggacac
gttgaccatggtaaaacaactttaactgctgctatcacaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgcgagcgc
ggtatcacaatctctactgcacacgttgagtacgaaactgaaactcgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatg
gacggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccatacatcgttgtattcttaaacaaatgcgac
atggtagacgacgaagaacttcttgaactagttgaaatggaagttcgcgatcttcttagc
gaatacgacttccctggcgatgatgtaccagttgttaaaggttctgctcttaaagctctt
gaaggagacgctgagtgggaagctaaaatcttcgaacttatggatgcggttgatgagtac
atcccaactccagaacgcgacactgaaaaaccattcatgatgccagttgaggacgtattc
tcaatcactggtcgtggtacagttgctactggccgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtcttcaagaagagaacaagaaaacaactgttacaggt
gttgaaatgttccgtaagcttcttgattacgctgaagctggtgacaacattggtgccctt
cttcgcggtgtatctcgtgaagaaatccaacgtggtcaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttacgttctttctaaagaagagggtgga
cgtcatactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatccatcttccagaaggcgtagaaatggttatgcctggagataacactgaa
atgaacgttgaacttatttctacaatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtactgttggttcaggcgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system