KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_01650Help
Entry
I653_01650        CDS       T02520                                 

Definition
(GenBank) nitrate transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    I653_01650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsy02000]
    I653_01650
Transporters [BR:bsy02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    I653_01650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 LacY_symp Ni_hydr_CYTB
Motif
Other DBs
NCBI-ProteinID: AGI27600
LinkDB All DBs
Position
353893..355098
Genome map
AA seq 401 aa AA seqDB search
MKLSELKTSGHPLTLLCSFLYFDVSFMIWVMLGALGVYISQDFGLSPFEKGLVVAVPILS
GSVFRIILGILTDRIGPKKTAVIGMLVTMIPLLWGTFGGRSLTELYAIGILLGVAGASFA
VALPMASRWYPPHLQGLAMGIAGAGNSGTLFATLFGPRLAEQFGWHIVMGIALIPLLIVF
ILFVSMAKDSPAQPSPQPLKSYLHVFGQKETWFFCLLYSVTFGGFVGLSSFLSIFFVDQY
QLSKIHAGDFVTLCVAAGSFFRPVGGLISDRVGGTKVLSVLFVIVALCMAGVSSLPSLSM
VIVLLFVGMMGLGMGNGAVFQLVPQRFRKEIGMVTGIVGAAGGIGGFFLPNILGSLKQMT
GTYAIGFITFSCIALLAFALVLAAGYYWRKSWSAESSPADV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcggaactgaaaactagcggtcatccactcacgttgctctgttccttttta
tactttgatgtcagttttatgatatgggttatgcttggggcgctgggtgtttatatttct
caggattttggcctgtctccttttgagaaagggcttgtcgtagctgtgccgattttatct
ggatcagtgtttcgtatcattcttggtattttaacggacagaatcggaccgaaaaaaacg
gcagtgatcgggatgctggtgacgatgattccgctgctttgggggacattcggcggccgt
tccctgactgaactgtatgccatcgggattctgcttggcgtggcgggggcaagctttgct
gtagcgctgcctatggccagccgctggtatcctcctcatttgcagggacttgcgatgggg
attgctggagcggggaacagcggcacgttgtttgcaaccctgtttggccctcgtctggca
gagcagttcggctggcacattgtcatgggaattgcgcttattccattattgatcgtcttt
attctttttgtatccatggcaaaggattctcctgcacagccgtctccgcagccgctcaaa
agctatctgcatgtgttcgggcaaaaggaaacatggtttttctgcctgctgtacagcgtc
acatttggcggatttgtcgggctctcaagctttttatcaattttctttgttgatcaatac
cagctgtcaaaaattcacgcgggcgacttcgttacattatgtgtggcggcggggagcttt
ttccggcctgtcgggggcttgatttcggatcgtgtcggcggcacgaaagttctttctgta
ctgtttgtcatcgtggcactgtgtatggccggagtcagcagcctgccatctctttcaatg
gttattgttctattgtttgtcggaatgatggggctcggaatgggtaacggtgcagtattc
cagctcgtgccgcagcgttttcgcaaagaaattggcatggtgacgggaatcgtcggtgcg
gccggaggaatcggagggtttttcctgccgaacatcttaggatctctcaaacagatgaca
ggcacatatgctatcggttttatcacgttttcctgtatcgcgctgctggcgtttgcactt
gtccttgccgcaggctattactggcggaaaagctggagcgcggaaagcagcccggcggat
gtttag

DBGET integrated database retrieval system