KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_02335Help
Entry
I653_02335        CDS       T02520                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00473  D-Alanine metabolism
bsy00550  Peptidoglycan biosynthesis
bsy01100  Metabolic pathways
bsy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    I653_02335 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I653_02335 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    I653_02335 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsy01011]
    I653_02335 (ddl)
Enzymes [BR:bsy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     I653_02335 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bsy01011]
 Precursor biosynthesis
  Amino acid ligase
   I653_02335 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3 DUF4573
Motif
Other DBs
NCBI-ProteinID: AGI27732
LinkDB All DBs
Position
499385..500470
Genome map
AA seq 361 aa AA seqDB search
MKTSLGLVYGGKSAEHNVSLQTALAVIKALNTEKFDIHPIYITEKGEWVRGARLTEPVSN
VKMLQFEQGGSAFSPAALNQEMFPQEASQQNEAIDVVFPLLHGPNGEDGTIQGMLELLNI
PYVGNGVLASSAGMDKVVMKHLFAQAGLAQAKYAAFLKKDWTRSPKESCEQVEQELGYPC
FVKPANLGSSVGISKCRNREELQKAFELAFQYDRKVVVEEGINGREIEIGVLGNDDPKCS
VVGEIAPKTDFYDYKAKYEDGDTDLMIPAIVTDEEYATISDMAIKAFKAIDGSGLVRADF
FLTADGEVLINEVNTMPGFTPFSMFPLLWKEAGVEYADLIEQLVELAKERHAEKQLIKHT
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaagtctaggattagtgtacggaggaaagtcggcagaacataatgtttccctg
cagacagctctggctgtaatcaaagcgctaaatactgagaagtttgatatacatccgatt
tatataacagaaaaaggcgaatgggttagaggcgcccgtttaactgagcctgtttcaaac
gtgaaaatgcttcaatttgagcaaggaggcagtgctttttctccagctgccctgaaccag
gagatgtttccgcaggaagcgtcacagcaaaatgaagccatcgacgtcgtattcccgctc
ctccacggaccgaacggagaagacggtacgatccagggaatgctcgagctgttgaacatt
ccttatgtcggcaacggagtgcttgcttcctcagctggcatggataaagttgtcatgaaa
catttatttgcgcaggccggccttgctcaggctaaatacgcagctttccttaagaaagac
tggactcgttctccgaaagaaagctgtgagcaggttgaacaggaattaggctacccttgc
ttcgtaaaaccggcgaacctcggctcaagtgtcggaatcagcaaatgccgaaaccgtgaa
gaactgcaaaaagcgtttgagcttgctttccaatatgatcgcaaagtcgtcgttgaagaa
ggaattaacggccgcgagattgagattggcgttcttggaaatgacgatcctaaatgctct
gttgtgggagaaatcgcaccgaagacagatttctacgattacaaagcgaaatatgaggat
ggagatactgatctgatgattccggcgattgtgactgatgaggaatacgcaacaatcagt
gatatggcgatcaaagcgtttaaagcgatcgatggttcaggactcgtcagagcggacttt
ttcctgacagctgacggcgaagttctgatcaatgaagtcaacacaatgcctggctttaca
cctttcagcatgttcccgctgctctggaaagaagccggagtggaatatgctgacctgatt
gaacagcttgtggagcttgcaaaagaacgccacgctgaaaaacaattgattaagcataca
ttctaa

DBGET integrated database retrieval system