KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_04675Help
Entry
I653_04675        CDS       T02520                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00564  Glycerophospholipid metabolism
bsy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    I653_04675
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     I653_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGI28197
LinkDB All DBs
Position
968230..969897
Genome map
AA seq 555 aa AA seqDB search
MMKHQFSSLERDRMLTDMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGT
SSRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFT
TSIGLRVYDFLAGVKKSERRSMLSAKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEV
MKEAVKFGAEPVNYSKVKELLYEKGKAVGVLIEDVLTKKEYKVYAKKIVNATGPWVDQLR
EKDHSKNGKHLQHTKGIHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVY
KEALEHPRMTTEDRDYVIKSINYMFPELNITANDIESSWAGLRPLIHEEGKDPSEISRKD
EIWTSDSGLITIAGGKLTGYRKMAEHIVDLVRDRLKEEGEKDFGPCKTKNMPISGGHVGG
SKNLMSFVTTKTKEGIAAGLSEKDAKQLAIRYGSNVDRVFDRVEALKDEAAKRNIPVHIL
AEAEYSIEEEMTATPADFFVRRTGRLFFDINWVRTYKDAVIDFMSERFQWDEQAKNKHTE
NLNKLLHDAVVPLEQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacatcaattttcaagtcttgaaagagatcgcatgctgacagacatgacgaaa
aaaacatatgacctatttattatcggaggaggaattacaggagccggaacagctcttgac
gcggcatcaaggggaatgaaggtcgcactaagcgaaatgcaggactttgcggcgggaaca
tcaagccgatcaacgaagctggtacatggcggcttgcgctatttaaaacaatttgaagtg
aaaatggtcgctgaggtaggaaaagagcgggcgattgtgtatgaaaacggcccgcatgtc
actacaccggaatggatgctgcttccgtttcataaaggcggcacattcggttcatttaca
acatctatcgggttaagagtttatgacttccttgcaggtgtgaaaaagtcagaacgaaga
agcatgctttcagcaaaagaaacgctgcaaaaagagcctttggtgaaaaaagacggctta
aaaggcggcgggtattatgtggaataccgcactgacgatgcgagactgaccatcgaagtc
atgaaggaagcggtgaaattcggggcagagcctgtgaattactccaaagtgaaggagctt
ctttacgaaaaaggcaaagccgtcggcgtattaattgaagatgtgctgacaaagaaagaa
tataaagtgtatgcgaaaaaaattgtcaatgctacaggcccttgggtcgatcagctcaga
gaaaaagaccattcgaaaaacggaaagcatttgcagcatacaaaaggcattcaccttgta
tttgaccagtctgtctttccgctgaaacaggctgtatatttcgatacacctgatggccgg
atggtatttgcgattcctcgtgaaggcaaaacatacgtgggaacaacagacactgtttac
aaagaggcgctggagcatcctcggatgacaacggaggatcgtgattatgtcatcaaatca
atcaattacatgttcccggaactgaatatcactgcgaatgacatcgaatccagctgggcg
gggctgcgtccgctgattcatgaagaaggcaaagatccttctgaaatttcacggaaagac
gagatttggacatctgactcaggcctgatcaccattgccggcggaaaactgactggatac
agaaaaatggcggagcacatcgttgatcttgtccgtgatcgcttaaaagaagagggcgaa
aaggattttggaccatgtaaaacgaaaaacatgccaatctctggcgggcacgtcggcggt
tcgaaaaatctcatgtccttcgttaccacgaaaacaaaagaaggaattgcagccggttta
tcagaaaaagacgcaaaacagctggcgatcagatacggctctaacgtagatcgcgtcttt
gaccgggtagaagcgctgaaagatgaagccgcgaaacgcaacattccggttcatattctt
gctgaggcagaatacagtatagaagaagagatgactgcaacccctgctgacttctttgtc
cgcagaacgggacgtttattttttgatatcaattgggtaagaacatataaagatgccgtt
attgattttatgagcgagcgattccaatgggatgagcaggcgaaaaacaaacatacagaa
aacctcaacaagcttttacacgatgcggtcgtaccgcttgagcaataa

DBGET integrated database retrieval system