KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_04885
Entry
I653_04885        CDS       T02520                                 
Name
(GenBank) hypothetical protein
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
SSDB
Other DBs
NCBI-ProteinID: AGI28239
LinkDB
Position
1009814..1010122
AA seq 102 aa
MKSEWKEGLLCQGIYVFIKQFHIGAANLLFCFRERFFRSDRALKSAVRNISVKKGMELTL
HAFFIYKIYGKTGVWDVKTNTEARAVRAKLDEKSCKEKIEGG
NT seq 309 nt   +upstreamnt  +downstreamnt
atgaaatcagaatggaaggagggtttgctatgccaaggaatttacgtgtttatcaaacag
tttcatattggcgcggcaaaccttttgttctgttttcgtgaacggttttttaggtcagac
cgcgcgctgaaaagcgctgtgcgtaacatatcggttaaaaaaggcatggagctgacgctt
catgccttttttatatacaaaatctatggaaagacaggtgtatgggatgtgaagacaaat
acagaggcgagggctgttcgtgccaaattggatgaaaaaagctgcaaggaaaaaatagaa
ggcggctga

DBGET integrated database retrieval system