KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_05930Help
Entry
I653_05930        CDS       T02520                                 

Definition
(GenBank) FAD-dependent glycine oxidase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00730  Thiamine metabolism
bsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    I653_05930
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     I653_05930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox_3 FAD_binding_2 HI0933_like Pyr_redox_2 FAD_oxidored Pyr_redox ApbA GIDA
Motif
Other DBs
NCBI-ProteinID: AGI28442
LinkDB All DBs
Structure
PDB: 

Position
1207803..1208912
Genome map
AA seq 369 aa AA seqDB search
MKRHYEAVVIGGGIIGSAIAYHLAKENKSTALFESGTMGGRTTSAAAGMLGAHAECEERD
AFFDFAMHSQRLYKGLGEELYAISGVDIRQHNGGMFKLAFSEEDVLQLRQMDDLDSVSWY
SKEEVLEKEPYASGDIFGASFIQDDVHVEPYFVCKAYVKAAKMLGAEIFEHTPVLHVERD
GEALSIKTPSGDVWANHVVVASGVWSGMFFKQLGLNNAFLPVKGECLSVWNDDIPLTKTL
YHDHCYIVPRKSGRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWAG
LRPGTKDGKPYIGRHPEDSRILFAAGHFRNGILLAPATGALISDLIMNKEVNQDWLHAFR
IDRKEAVQI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggcattatgaagcagtggtgattggaggcggaattatcggttccgcgattgct
tatcatttggcaaaggaaaacaaaagcaccgcattatttgaaagcggaacaatgggcggc
agaacgacaagtgccgctgccggaatgctgggcgcccatgccgaatgcgaggaacgtgac
gcgttttttgatttcgccatgcacagccagcgtctgtacaaaggtcttggagaagagctt
tatgcaatatccggtgtggatatcaggcagcataacggcggtatgtttaagcttgcattt
tctgaagaagatgtgctgcagctgagacagatggacgatttggactctgtcagctggtat
tcaaaagaagaggtgttagaaaaagagccgtatgcgtctggtgacatctttggtgcatct
tttattcaggatgatgtgcatgtggagccttattttgtttgcaaggcatatgtgaaagca
gcaaaaatgcttggggcggagatttttgagcatacgcccgtcctgcatgtcgaacgtgac
ggtgaagccctgtccatcaagacccctagtggagacgtatgggctaatcatgttgtcgtt
gccagcggggtgtggagcggaatgttttttaaacagctcggactgaacaatgcttttctc
cctgtaaaaggggagtgcctgtccgtttggaatgatgatatcccgctgacaaaaacgctt
taccatgaccattgctatatcgtaccgagaaaaagcggcagactggttgtcggcgcgaca
atgaagccgggggactggagtgaaacaccggatcttggcggattggaatcggttatgaaa
aaagcaaaaacgatgctgccggctatacagaatatgaaggtggatcgtttttgggcggga
ctccggccgggaacaaaggatggaaaaccgtacatcggcagacatcctgaggacagccgt
attttatttgcggctggccatttcagaaatgggatcctgcttgctcccgcaacgggcgct
ttgatcagtgatctcatcatgaataaagaggtcaaccaagactggctgcacgcattccga
attgatcgcaaggaggcggttcagatatga

DBGET integrated database retrieval system