KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_12030Help
Entry
I653_12030        CDS       T02520                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Brite
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     I653_12030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGI29655
LinkDB All DBs
Structure
PDB: 

Position
complement(2401440..2402048)
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMTIHHTKHHNTYVTNLNKAVEGNTALANKSVEELVAD
LDSVPENIRTAVRNNGGGHANHKLFWTLLSPNGGGEPTGALAEEINSVFGSFDKFKEQFA
AAAAGRFGSGWAWLVVNNGKLEITSTPNQDSPLSEGKTPILGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVARLYSEAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgaacttccagaattaccttatgcgtacgatgctttagaaccgcatatcgac
aaggaaactatgactattcaccatacgaaacaccacaacacatacgtgacaaatttaaac
aaagcggttgaaggaaacactgctcttgccaacaaatcagttgaagagcttgttgcagat
cttgattctgttcctgaaaacatccgcactgcagtccgcaacaacggcggcggacacgcg
aaccacaaattattctggacacttttatctccaaacggcggaggcgaaccgactggcgcg
cttgctgaagagatcaacagtgtatttggaagctttgacaaattcaaagagcaattcgca
gcagctgcagctggacgcttcggttctggctgggcatggcttgttgtgaacaacggtaaa
cttgaaatcacaagcacgccaaaccaagattctccgctttcagaaggcaaaacgcctatc
ttaggtcttgacgtttgggagcatgcttactaccttaactatcaaaaccgccgtcctgat
tacatttcagctttctggaatgttgtaaactgggacgaagtggctcgtctatacagcgaa
gcaaaataa

DBGET integrated database retrieval system