KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_12830
Entry
I653_12830        CDS       T02520                                 

Definition
(GenBank) phosphotransferase system (PTS) fructose-specific enzyme IID component
  KO
K02771  fructose PTS system EIID component
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00051  Fructose and mannose metabolism
bsy02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    I653_12830
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    I653_12830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsy02000]
    I653_12830
Transporters [BR:bsy02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    I653_12830
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AGI29813
LinkDB
Position
complement(2534775..2535602)
AA seq 275 aa
MEKEKRLTKKEIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNEALQR
HLEWFNTHPWLTAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTI
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLSTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDESGKVDVQTVQNVLDSIMPGALPLGL
TLLVAWMLRKGVNPLLIICGIFVIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagaaagaaaaacgattaacgaaaaaagaaattttcagcatgtttattcgttcaaat
tttttactcggttcctttaacttcgaacgtgtgcaggcaatgggatattgttatgtcatg
ataccggcgatcaaaaaattgtacggtcccggagcgaaaagaaacgaagccttgcagcgg
catttggaatggtttaatacacatccgtggctgacagcgcctatatttggcgtgacggca
gccatggaagaagaaatggcgaacaataaaggaattgacggaaaagcgataagcggaatg
aaaatcggtttgatgggaccaatagcgggcgtaggcgacccgattttctggggaacgatt
cgtcctgtcttagctgcgctaggagcctcccttgctttaggaggaaacattgccggtcct
ttgctattctttttcttgctgaatgccataagattaagcacaaaatattacggattaaag
tatggctatgtgaaaggaatggagattcttcaggatttagcggggaatcgcattcaaaag
cttacagagggcgcttcgattctcggattatttgttatgggggctctcgtgtccaaatgg
accaccatcaacattccaatcgttgtatccaggattaaggatgaaagcggaaaagtagat
gttcaaactgtacaaaacgtgttagacagcattatgccgggtgcgctgcctctcggatta
acgttattggtggcatggatgcttcgcaaaggggtgaatcctcttctcattatttgcggc
atctttgtcatcgggattctcgggtattgggctggattcttagcataa

DBGET integrated database retrieval system